BLASTX nr result
ID: Coptis25_contig00040153
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00040153 (616 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN77786.1| hypothetical protein VITISV_023232 [Vitis vinifera] 44 3e-06 >emb|CAN77786.1| hypothetical protein VITISV_023232 [Vitis vinifera] Length = 377 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 25/47 (53%), Positives = 33/47 (70%) Frame = -3 Query: 590 VGFGFDHIAEKYKVVRIFKLSFDDNSQTYMKGQIITLGEAPWRELEV 450 VG G+D KYKVVR S+ DNS+ + + +IITLGEA WR+L+V Sbjct: 152 VGLGYDPWNMKYKVVR----SYIDNSK-FTRFEIITLGEASWRQLDV 193 Score = 32.7 bits (73), Expect(2) = 3e-06 Identities = 10/25 (40%), Positives = 17/25 (68%) Frame = -2 Query: 447 VICCSNKKPVFLDGLLHWFIDAKRH 373 V+C N +P++ +G L+W +D K H Sbjct: 197 VVCGRNSRPIYCEGALYWILDKKFH 221