BLASTX nr result
ID: Coptis25_contig00040116
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00040116 (209 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCO62222.1| putative cytochrome P450 monooxygenase [Actaea r... 56 3e-06 >emb|CCO62222.1| putative cytochrome P450 monooxygenase [Actaea racemosa] Length = 507 Score = 56.2 bits (134), Expect = 3e-06 Identities = 30/44 (68%), Positives = 35/44 (79%) Frame = -3 Query: 207 EIRKITVLEVLSTKRVQSLRTVREEEVALMIALIASSYGTINLS 76 EIRKI V E+LS K+VQS T REEEVAL+IA IASS+G +LS Sbjct: 138 EIRKICVSELLSAKKVQSFHTAREEEVALLIASIASSHGPTDLS 181