BLASTX nr result
ID: Coptis25_contig00040092
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00040092 (400 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004164292.1| PREDICTED: U-box domain-containing protein 2... 66 3e-09 ref|XP_004147364.1| PREDICTED: U-box domain-containing protein 2... 66 3e-09 ref|XP_002526642.1| Spotted leaf protein, putative [Ricinus comm... 66 3e-09 ref|XP_003531998.1| PREDICTED: U-box domain-containing protein 2... 65 4e-09 ref|XP_003526867.1| PREDICTED: U-box domain-containing protein 2... 64 2e-08 >ref|XP_004164292.1| PREDICTED: U-box domain-containing protein 26-like [Cucumis sativus] Length = 399 Score = 66.2 bits (160), Expect = 3e-09 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +1 Query: 301 DDQMNIPHLFKCPISLDLFKDPVTLCTGQTYDR 399 DD IPHLF+CPISLDLFKDPVTLCTGQTY+R Sbjct: 5 DDHETIPHLFRCPISLDLFKDPVTLCTGQTYER 37 >ref|XP_004147364.1| PREDICTED: U-box domain-containing protein 26-like [Cucumis sativus] Length = 399 Score = 66.2 bits (160), Expect = 3e-09 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +1 Query: 301 DDQMNIPHLFKCPISLDLFKDPVTLCTGQTYDR 399 DD IPHLF+CPISLDLFKDPVTLCTGQTY+R Sbjct: 5 DDHETIPHLFRCPISLDLFKDPVTLCTGQTYER 37 >ref|XP_002526642.1| Spotted leaf protein, putative [Ricinus communis] gi|223534034|gb|EEF35754.1| Spotted leaf protein, putative [Ricinus communis] Length = 404 Score = 66.2 bits (160), Expect = 3e-09 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = +1 Query: 295 MKDDQMNIPHLFKCPISLDLFKDPVTLCTGQTYDR 399 M++ +M IPHLF CPISLDLF+DPVTLCTGQTYDR Sbjct: 1 MREAEMTIPHLFICPISLDLFRDPVTLCTGQTYDR 35 >ref|XP_003531998.1| PREDICTED: U-box domain-containing protein 25-like [Glycine max] Length = 388 Score = 65.5 bits (158), Expect = 4e-09 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = +1 Query: 295 MKDDQMNIPHLFKCPISLDLFKDPVTLCTGQTYDR 399 M + Q IPHLF+CPISLDLF+DPVTLCTGQTYDR Sbjct: 1 MNESQNAIPHLFRCPISLDLFEDPVTLCTGQTYDR 35 >ref|XP_003526867.1| PREDICTED: U-box domain-containing protein 25-like [Glycine max] Length = 394 Score = 63.5 bits (153), Expect = 2e-08 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +1 Query: 307 QMNIPHLFKCPISLDLFKDPVTLCTGQTYDR 399 ++ IPHLF+CPISLDLF+DPVTLCTGQTYDR Sbjct: 7 EITIPHLFRCPISLDLFEDPVTLCTGQTYDR 37