BLASTX nr result
ID: Coptis25_contig00039944
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00039944 (432 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACX54452.1| hypothetical protein F207 [Epipremnum aureum] 57 2e-06 >gb|ACX54452.1| hypothetical protein F207 [Epipremnum aureum] Length = 52 Score = 57.0 bits (136), Expect = 2e-06 Identities = 25/49 (51%), Positives = 36/49 (73%), Gaps = 2/49 (4%) Frame = -1 Query: 387 CNSFRGCLSLTRYGLGLVPASCAFLGVLITYSMDLH--PTKPLTEPLLS 247 C+ + C S+TRYG GL+PA+CA +G ++TY+M L+ TK L EPLL+ Sbjct: 4 CHDIKSCQSVTRYGSGLIPAACALVGAVVTYTMKLYDPTTKSLLEPLLA 52