BLASTX nr result
ID: Coptis25_contig00039828
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00039828 (265 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528283.1| pentatricopeptide repeat-containing protein,... 55 6e-06 >ref|XP_002528283.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223532320|gb|EEF34121.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 602 Score = 55.1 bits (131), Expect = 6e-06 Identities = 29/72 (40%), Positives = 38/72 (52%) Frame = -3 Query: 221 KTKSPTCXXXXXXXXXXXXXXKEVVNSLQLLITKGIRXXXXXXXXLIQQCANTNSLQQGK 42 +TK C + ++SL LL GIR L+QQCANT SL+ GK Sbjct: 11 RTKRVPCIVKSLLHLSSQGQLFQAISSLGLLSRNGIRLPSKTLAYLLQQCANTKSLKLGK 70 Query: 41 WVHLYLRLTGFK 6 WVHL+L++TG K Sbjct: 71 WVHLHLKVTGLK 82