BLASTX nr result
ID: Coptis25_contig00039707
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00039707 (311 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAC63844.1| putative non-LTR retroelement reverse transcripta... 55 4e-06 gb|AAB82639.1| putative non-LTR retroelement reverse transcripta... 47 8e-06 >gb|AAC63844.1| putative non-LTR retroelement reverse transcriptase [Arabidopsis thaliana] Length = 1231 Score = 55.5 bits (132), Expect = 4e-06 Identities = 27/52 (51%), Positives = 37/52 (71%) Frame = +1 Query: 154 GPWLLFGDFNAIISPDEKIGGNSVMNKCMLDFNDFVNDIGLFIDLGFKGPKF 309 GP L+ GDFN I+ DE++GGN ++ L F D++N++ L IDLGFKG KF Sbjct: 31 GPLLIGGDFNTILWVDERMGGNGRLSPDSLAFGDWINELSL-IDLGFKGNKF 81 >gb|AAB82639.1| putative non-LTR retroelement reverse transcriptase [Arabidopsis thaliana] Length = 1374 Score = 47.4 bits (111), Expect(2) = 8e-06 Identities = 19/42 (45%), Positives = 26/42 (61%) Frame = +1 Query: 154 GPWLLFGDFNAIISPDEKIGGNSVMNKCMLDFNDFVNDIGLF 279 GPW+L GDFN ++ P EKIGG + L+F +N GL+ Sbjct: 129 GPWMLTGDFNELVDPSEKIGGPARKESSCLEFRQMLNSCGLW 170 Score = 26.9 bits (58), Expect(2) = 8e-06 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = +2 Query: 50 DWYFTFVYGDPVMHRRKIVWDEIRTL 127 ++Y T +YG+PV R +W+ + L Sbjct: 98 EFYLTCIYGEPVQAERGELWERLTRL 123