BLASTX nr result
ID: Coptis25_contig00039618
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00039618 (263 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACM68432.1| xyloglucanase-specific endoglucanase inhibitor pr... 84 9e-15 ref|NP_001234249.1| xyloglucan-specific fungal endoglucanase inh... 83 3e-14 ref|NP_001234746.1| xyloglucan-specific fungal endoglucanase inh... 83 3e-14 gb|ADG23123.1| xyloglucan specific endoglucanase inhibitor [Sola... 83 3e-14 gb|AAP84703.1| putative xyloglucanase inhibitor [Solanum tuberosum] 83 3e-14 >gb|ACM68432.1| xyloglucanase-specific endoglucanase inhibitor protein [Petunia x hybrida] Length = 436 Score = 84.3 bits (207), Expect = 9e-15 Identities = 38/56 (67%), Positives = 46/56 (82%) Frame = -1 Query: 170 RALVLSITKDASTLQYTTIIRQRTPLATINVVLDLGGQFLWVDCEQFYESSSYVPA 3 + L+L +TKDASTLQY T I QRTPL +++ LDLGGQFLWVDC+Q Y SSSY+PA Sbjct: 31 KGLILPVTKDASTLQYLTQISQRTPLVPVSLTLDLGGQFLWVDCDQGYVSSSYIPA 86 >ref|NP_001234249.1| xyloglucan-specific fungal endoglucanase inhibitor protein precursor [Solanum lycopersicum] gi|27372527|gb|AAN87262.1| xyloglucan-specific fungal endoglucanase inhibitor protein precursor [Solanum lycopersicum] Length = 438 Score = 82.8 bits (203), Expect = 3e-14 Identities = 38/56 (67%), Positives = 46/56 (82%) Frame = -1 Query: 170 RALVLSITKDASTLQYTTIIRQRTPLATINVVLDLGGQFLWVDCEQFYESSSYVPA 3 + L++ +TKDASTLQY T I+QRTPL I++ LDLGGQFLWVDC+Q Y SSSY PA Sbjct: 32 KGLIIPVTKDASTLQYLTQIQQRTPLVPISLTLDLGGQFLWVDCDQGYVSSSYKPA 87 >ref|NP_001234746.1| xyloglucan-specific fungal endoglucanase inhibitor protein precursor [Solanum lycopersicum] gi|68449754|gb|AAY97864.1| xyloglucan-specific fungal endoglucanase inhibitor protein precursor [Solanum lycopersicum] Length = 438 Score = 82.8 bits (203), Expect = 3e-14 Identities = 38/56 (67%), Positives = 46/56 (82%) Frame = -1 Query: 170 RALVLSITKDASTLQYTTIIRQRTPLATINVVLDLGGQFLWVDCEQFYESSSYVPA 3 + L++ +TKDASTLQY T I+QRTPL I++ LDLGGQFLWVDC+Q Y SSSY PA Sbjct: 32 KGLIIPVTKDASTLQYLTQIQQRTPLVPISLTLDLGGQFLWVDCDQGYVSSSYKPA 87 >gb|ADG23123.1| xyloglucan specific endoglucanase inhibitor [Solanum melongena] Length = 437 Score = 82.8 bits (203), Expect = 3e-14 Identities = 38/56 (67%), Positives = 46/56 (82%) Frame = -1 Query: 170 RALVLSITKDASTLQYTTIIRQRTPLATINVVLDLGGQFLWVDCEQFYESSSYVPA 3 + L++ +TKDASTLQY T I+QRTPL I++ LDLGGQFLWVDC+Q Y SSSY PA Sbjct: 32 KGLIIPVTKDASTLQYLTQIQQRTPLVPISLTLDLGGQFLWVDCDQGYVSSSYKPA 87 >gb|AAP84703.1| putative xyloglucanase inhibitor [Solanum tuberosum] Length = 437 Score = 82.8 bits (203), Expect = 3e-14 Identities = 38/56 (67%), Positives = 46/56 (82%) Frame = -1 Query: 170 RALVLSITKDASTLQYTTIIRQRTPLATINVVLDLGGQFLWVDCEQFYESSSYVPA 3 + L++ +TKDASTLQY T I+QRTPL I++ LDLGGQFLWVDC+Q Y SSSY PA Sbjct: 32 KGLIIPVTKDASTLQYLTQIQQRTPLVPISLTLDLGGQFLWVDCDQGYVSSSYKPA 87