BLASTX nr result
ID: Coptis25_contig00039553
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00039553 (330 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004161840.1| PREDICTED: beta-glucosidase 44-like [Cucumis... 69 5e-10 ref|XP_004137494.1| PREDICTED: beta-glucosidase 44-like [Cucumis... 69 5e-10 ref|XP_003528968.1| PREDICTED: beta-glucosidase 44-like [Glycine... 68 7e-10 ref|XP_002533126.1| beta-glucosidase, putative [Ricinus communis... 67 2e-09 gb|ABC55717.1| beta-mannosidase 2 [Oncidium Gower Ramsey] 67 2e-09 >ref|XP_004161840.1| PREDICTED: beta-glucosidase 44-like [Cucumis sativus] Length = 503 Score = 68.6 bits (166), Expect = 5e-10 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -2 Query: 329 GYTSRFGIVYVDYKDLKRYPKMSAYWFKTMLARKK 225 GYTSRFGIVYVDY +LKRYPKMSAYWFK +L RKK Sbjct: 468 GYTSRFGIVYVDYSNLKRYPKMSAYWFKQLLERKK 502 >ref|XP_004137494.1| PREDICTED: beta-glucosidase 44-like [Cucumis sativus] Length = 503 Score = 68.6 bits (166), Expect = 5e-10 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -2 Query: 329 GYTSRFGIVYVDYKDLKRYPKMSAYWFKTMLARKK 225 GYTSRFGIVYVDY +LKRYPKMSAYWFK +L RKK Sbjct: 468 GYTSRFGIVYVDYSNLKRYPKMSAYWFKQLLERKK 502 >ref|XP_003528968.1| PREDICTED: beta-glucosidase 44-like [Glycine max] Length = 515 Score = 68.2 bits (165), Expect = 7e-10 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = -2 Query: 329 GYTSRFGIVYVDYKDLKRYPKMSAYWFKTMLARKK 225 GYTSRFGIVYVD+K LKRYPKMSAYWFK ++A+KK Sbjct: 480 GYTSRFGIVYVDFKTLKRYPKMSAYWFKQLIAKKK 514 >ref|XP_002533126.1| beta-glucosidase, putative [Ricinus communis] gi|223527070|gb|EEF29253.1| beta-glucosidase, putative [Ricinus communis] Length = 517 Score = 67.0 bits (162), Expect = 2e-09 Identities = 30/35 (85%), Positives = 31/35 (88%) Frame = -2 Query: 329 GYTSRFGIVYVDYKDLKRYPKMSAYWFKTMLARKK 225 GYTSRFGIVYVD+ LKRYPKMSAYWFK ML RKK Sbjct: 482 GYTSRFGIVYVDFTTLKRYPKMSAYWFKQMLQRKK 516 >gb|ABC55717.1| beta-mannosidase 2 [Oncidium Gower Ramsey] Length = 501 Score = 66.6 bits (161), Expect = 2e-09 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -2 Query: 329 GYTSRFGIVYVDYKDLKRYPKMSAYWFKTMLARKK 225 GYTSRFGIVYVD+K LKRYPKMSAYWFK +L +KK Sbjct: 467 GYTSRFGIVYVDFKTLKRYPKMSAYWFKDVLQKKK 501