BLASTX nr result
ID: Coptis25_contig00039494
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00039494 (306 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002323498.1| predicted protein [Populus trichocarpa] gi|2... 60 2e-07 >ref|XP_002323498.1| predicted protein [Populus trichocarpa] gi|222868128|gb|EEF05259.1| predicted protein [Populus trichocarpa] Length = 115 Score = 60.1 bits (144), Expect = 2e-07 Identities = 25/52 (48%), Positives = 33/52 (63%) Frame = -2 Query: 173 HFVPIKLNKGNFLLWKSLFLPILRSNNLLGYADGSLPCPQKFVCNDKGEITN 18 HF+ IKL + N+LLW++ +P LR NL GY DGS+PCP + N I N Sbjct: 23 HFITIKLTQDNYLLWRAQLIPYLRGQNLFGYLDGSVPCPAITIPNSSTHIPN 74