BLASTX nr result
ID: Coptis25_contig00039458
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00039458 (210 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002284253.2| PREDICTED: uncharacterized protein LOC100262... 56 3e-06 emb|CBI15137.3| unnamed protein product [Vitis vinifera] 56 3e-06 ref|XP_002514669.1| conserved hypothetical protein [Ricinus comm... 56 3e-06 >ref|XP_002284253.2| PREDICTED: uncharacterized protein LOC100262180 [Vitis vinifera] Length = 307 Score = 55.8 bits (133), Expect = 3e-06 Identities = 24/33 (72%), Positives = 27/33 (81%) Frame = +1 Query: 1 VYLTTWLVEVNIETHRVEETLTTVGEEMHVSLS 99 VYLTTWL EVNI+THRV+E +GEEMHV LS Sbjct: 275 VYLTTWLAEVNIDTHRVDEIFAVIGEEMHVGLS 307 >emb|CBI15137.3| unnamed protein product [Vitis vinifera] Length = 303 Score = 55.8 bits (133), Expect = 3e-06 Identities = 24/33 (72%), Positives = 27/33 (81%) Frame = +1 Query: 1 VYLTTWLVEVNIETHRVEETLTTVGEEMHVSLS 99 VYLTTWL EVNI+THRV+E +GEEMHV LS Sbjct: 271 VYLTTWLAEVNIDTHRVDEIFAVIGEEMHVGLS 303 >ref|XP_002514669.1| conserved hypothetical protein [Ricinus communis] gi|223546273|gb|EEF47775.1| conserved hypothetical protein [Ricinus communis] Length = 285 Score = 55.8 bits (133), Expect = 3e-06 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = +1 Query: 1 VYLTTWLVEVNIETHRVEETLTTVGEEMHVSLS 99 VYLTTWL EVNI+THRV+E +G+EMHVSLS Sbjct: 253 VYLTTWLAEVNIDTHRVDEIFAIIGDEMHVSLS 285