BLASTX nr result
ID: Coptis25_contig00039453
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00039453 (403 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002278558.1| PREDICTED: pentatricopeptide repeat-containi... 59 2e-15 emb|CBI22241.3| unnamed protein product [Vitis vinifera] 59 2e-15 ref|XP_002871658.1| pentatricopeptide repeat-containing protein ... 44 2e-07 ref|XP_003562027.1| PREDICTED: pentatricopeptide repeat-containi... 44 4e-07 ref|XP_002533116.1| pentatricopeptide repeat-containing protein,... 47 2e-06 >ref|XP_002278558.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15280-like [Vitis vinifera] Length = 1273 Score = 58.5 bits (140), Expect(2) = 2e-15 Identities = 35/87 (40%), Positives = 52/87 (59%), Gaps = 1/87 (1%) Frame = -2 Query: 378 HCNEKQNLVSCSRDKINKPLEDFSSVKHVNIARSVILRCSYLWEKKD-ETYEEVRFKDIL 202 H ++ + S + + I K D S++ I +SVILRCS+LWE + + K+ L Sbjct: 59 HSSQSSSSSSVNEEAI-KTHVDLSAIDCSRIVKSVILRCSHLWETNSVKPFGYSSLKEHL 117 Query: 201 LKLSNISPALIRRFWRVSTLKPDDVLK 121 L +S+ISP R+F RVS LKP+DVL+ Sbjct: 118 LGISDISPETTRKFRRVSELKPEDVLE 144 Score = 48.5 bits (114), Expect(2) = 2e-15 Identities = 21/41 (51%), Positives = 28/41 (68%) Frame = -1 Query: 124 EILLGFEFDSGNVENEASKVGLLWKLFNWAGKQCEGFEHLP 2 EILLGF+F N + E+ KV LW +F W+ Q +GF+HLP Sbjct: 144 EILLGFQFHRENPQIESGKVESLWGIFKWSNDQNKGFKHLP 184 >emb|CBI22241.3| unnamed protein product [Vitis vinifera] Length = 1256 Score = 58.5 bits (140), Expect(2) = 2e-15 Identities = 35/87 (40%), Positives = 52/87 (59%), Gaps = 1/87 (1%) Frame = -2 Query: 378 HCNEKQNLVSCSRDKINKPLEDFSSVKHVNIARSVILRCSYLWEKKD-ETYEEVRFKDIL 202 H ++ + S + + I K D S++ I +SVILRCS+LWE + + K+ L Sbjct: 42 HSSQSSSSSSVNEEAI-KTHVDLSAIDCSRIVKSVILRCSHLWETNSVKPFGYSSLKEHL 100 Query: 201 LKLSNISPALIRRFWRVSTLKPDDVLK 121 L +S+ISP R+F RVS LKP+DVL+ Sbjct: 101 LGISDISPETTRKFRRVSELKPEDVLE 127 Score = 48.5 bits (114), Expect(2) = 2e-15 Identities = 21/41 (51%), Positives = 28/41 (68%) Frame = -1 Query: 124 EILLGFEFDSGNVENEASKVGLLWKLFNWAGKQCEGFEHLP 2 EILLGF+F N + E+ KV LW +F W+ Q +GF+HLP Sbjct: 127 EILLGFQFHRENPQIESGKVESLWGIFKWSNDQNKGFKHLP 167 >ref|XP_002871658.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297317495|gb|EFH47917.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 1223 Score = 43.9 bits (102), Expect(2) = 2e-07 Identities = 19/41 (46%), Positives = 27/41 (65%) Frame = -1 Query: 124 EILLGFEFDSGNVENEASKVGLLWKLFNWAGKQCEGFEHLP 2 E+LLGFE + ++KV LW++F WA Q +GF+HLP Sbjct: 103 ELLLGFESELQRGRIGSTKVQALWEIFRWASGQYQGFKHLP 143 Score = 35.8 bits (81), Expect(2) = 2e-07 Identities = 20/43 (46%), Positives = 29/43 (67%) Frame = -2 Query: 249 EKKDETYEEVRFKDILLKLSNISPALIRRFWRVSTLKPDDVLK 121 EK D T + KD+LL LS++ P +IRRF R LKP++V++ Sbjct: 63 EKLDLTGSSL--KDLLLDLSDVIPNIIRRFRRFPGLKPENVVE 103 >ref|XP_003562027.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15280-like, partial [Brachypodium distachyon] Length = 1278 Score = 43.9 bits (102), Expect(2) = 4e-07 Identities = 22/54 (40%), Positives = 32/54 (59%), Gaps = 1/54 (1%) Frame = -2 Query: 288 IARSVILRCSYLWEKKDETYE-EVRFKDILLKLSNISPALIRRFWRVSTLKPDD 130 I +I +CS ++E +T+E D+L +SP +RRFWR STLKP+D Sbjct: 94 IGELIIAKCSSIFESGRDTFEGNCSLHDLLKPGLWLSPETLRRFWRASTLKPED 147 Score = 34.7 bits (78), Expect(2) = 4e-07 Identities = 17/41 (41%), Positives = 21/41 (51%) Frame = -1 Query: 124 EILLGFEFDSGNVENEASKVGLLWKLFNWAGKQCEGFEHLP 2 +IL+GF G E K LW L+ WA Q + F HLP Sbjct: 150 DILIGF----GQGAAEIRKARFLWNLYRWASWQSKDFRHLP 186 >ref|XP_002533116.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223527079|gb|EEF29261.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 1204 Score = 47.4 bits (111), Expect(2) = 2e-06 Identities = 21/41 (51%), Positives = 27/41 (65%) Frame = -1 Query: 124 EILLGFEFDSGNVENEASKVGLLWKLFNWAGKQCEGFEHLP 2 EILLGF+F V ++SKV LW +F W Q +GF+HLP Sbjct: 65 EILLGFQFQCEQVAIKSSKVESLWGIFKWVSDQDKGFKHLP 105 Score = 29.3 bits (64), Expect(2) = 2e-06 Identities = 12/25 (48%), Positives = 19/25 (76%) Frame = -2 Query: 195 LSNISPALIRRFWRVSTLKPDDVLK 121 +S++ P L RRF R+ L+P+DVL+ Sbjct: 41 ISDVIPDLTRRFSRILRLRPEDVLE 65