BLASTX nr result
ID: Coptis25_contig00039303
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00039303 (265 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004168984.1| PREDICTED: pentatricopeptide repeat-containi... 79 3e-13 ref|XP_004146598.1| PREDICTED: pentatricopeptide repeat-containi... 79 3e-13 ref|XP_002531596.1| pentatricopeptide repeat-containing protein,... 75 6e-12 ref|XP_002330624.1| predicted protein [Populus trichocarpa] gi|2... 72 5e-11 ref|XP_003633265.1| PREDICTED: pentatricopeptide repeat-containi... 70 2e-10 >ref|XP_004168984.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, mitochondrial-like [Cucumis sativus] Length = 461 Score = 79.3 bits (194), Expect = 3e-13 Identities = 37/73 (50%), Positives = 53/73 (72%) Frame = +1 Query: 46 RALFYTNDTTPLRYDLYDRIDPVRDQSVSIVPVLDQWLKEGRNATKDDLIYIINTLRFYK 225 R+ F +T ++ +LY RI PV D ++S+ P+LDQW+ EGR +D+L +II LR YK Sbjct: 16 RSEFVNFYSTVVKDNLYRRISPVGDPNISVTPLLDQWVLEGRLVQQDELRHIIKELRVYK 75 Query: 226 RFRHALEISQWMT 264 RF+HALEIS+WM+ Sbjct: 76 RFKHALEISKWMS 88 >ref|XP_004146598.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, mitochondrial-like [Cucumis sativus] Length = 227 Score = 79.3 bits (194), Expect = 3e-13 Identities = 37/73 (50%), Positives = 53/73 (72%) Frame = +1 Query: 46 RALFYTNDTTPLRYDLYDRIDPVRDQSVSIVPVLDQWLKEGRNATKDDLIYIINTLRFYK 225 R+ F +T ++ +LY RI PV D ++S+ P+LDQW+ EGR +D+L +II LR YK Sbjct: 16 RSEFVNFYSTVVKDNLYRRISPVGDPNISVTPLLDQWVLEGRLVQQDELRHIIKELRVYK 75 Query: 226 RFRHALEISQWMT 264 RF+HALEIS+WM+ Sbjct: 76 RFKHALEISKWMS 88 >ref|XP_002531596.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223528792|gb|EEF30799.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 300 Score = 75.1 bits (183), Expect = 6e-12 Identities = 34/58 (58%), Positives = 42/58 (72%) Frame = +1 Query: 91 LYDRIDPVRDQSVSIVPVLDQWLKEGRNATKDDLIYIINTLRFYKRFRHALEISQWMT 264 LY RI PV D VSIVP+LDQW++EG++ KD L I LR+ KR+ HALEIS WM+ Sbjct: 51 LYRRISPVGDPKVSIVPILDQWIEEGKSVNKDQLQVFIKELRYCKRYTHALEISMWMS 108 >ref|XP_002330624.1| predicted protein [Populus trichocarpa] gi|222872228|gb|EEF09359.1| predicted protein [Populus trichocarpa] Length = 501 Score = 72.0 bits (175), Expect = 5e-11 Identities = 36/86 (41%), Positives = 54/86 (62%), Gaps = 2/86 (2%) Frame = +1 Query: 13 TNPKVLL--PRLSRALFYTNDTTPLRYDLYDRIDPVRDQSVSIVPVLDQWLKEGRNATKD 186 +NP + L + RAL ++ DTT + + L RI V D V ++PV+++W++EG+ T Sbjct: 7 SNPSLCLHIDGVLRALCFSTDTTAISHSLNRRISMVEDPMVPVIPVIEKWVQEGQVVTNS 66 Query: 187 DLIYIINTLRFYKRFRHALEISQWMT 264 DL + I LR RF HAL+ISQWM+ Sbjct: 67 DLKHFIRKLRKIHRFSHALQISQWMS 92 >ref|XP_003633265.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, mitochondrial-like [Vitis vinifera] Length = 461 Score = 69.7 bits (169), Expect = 2e-10 Identities = 30/58 (51%), Positives = 42/58 (72%) Frame = +1 Query: 91 LYDRIDPVRDQSVSIVPVLDQWLKEGRNATKDDLIYIINTLRFYKRFRHALEISQWMT 264 LYDRI VRD SI P+L+QW++EG+ +K L ++ ++ ++RF HALEISQWMT Sbjct: 24 LYDRIQAVRDPKASISPLLNQWIEEGQTVSKPQLQSLVRIMKDFRRFHHALEISQWMT 81