BLASTX nr result
ID: Coptis25_contig00039224
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00039224 (424 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002532847.1| pentatricopeptide repeat-containing protein,... 57 2e-06 >ref|XP_002532847.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223527384|gb|EEF29525.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 505 Score = 57.0 bits (136), Expect = 2e-06 Identities = 27/39 (69%), Positives = 31/39 (79%) Frame = +3 Query: 3 ISVLCKDGKWQEGEDLLNEMVTSGLRPSDSIYSTISKAR 119 I +LCKDGKWQE E LLN+M SGL PS SIY+ ISKA+ Sbjct: 460 IGILCKDGKWQEAEILLNKMRGSGLEPSVSIYNIISKAK 498