BLASTX nr result
ID: Coptis25_contig00039175
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00039175 (352 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002315323.1| predicted protein [Populus trichocarpa] gi|2... 101 6e-20 ref|XP_002311994.1| predicted protein [Populus trichocarpa] gi|2... 101 6e-20 ref|XP_002529601.1| Kinesin-II 85 kDa subunit, putative [Ricinus... 98 6e-19 ref|XP_002273191.2| PREDICTED: armadillo repeat-containing kines... 92 4e-17 emb|CBI31422.3| unnamed protein product [Vitis vinifera] 92 4e-17 >ref|XP_002315323.1| predicted protein [Populus trichocarpa] gi|222864363|gb|EEF01494.1| predicted protein [Populus trichocarpa] Length = 1067 Score = 101 bits (252), Expect = 6e-20 Identities = 51/79 (64%), Positives = 61/79 (77%) Frame = +1 Query: 115 VYIHKNSQGKAGSEPSSLARDTKIGVPVQNGVATILKSKLLIVDLAGSERIDKSGSEGHM 294 VY+ ++ KA E +S +D K + NG+ + KSKLLIVDLAGSER+DKSGSEGH+ Sbjct: 312 VYVRRSINQKAEDETTSQEKDVKSNLSGGNGIPRVRKSKLLIVDLAGSERLDKSGSEGHL 371 Query: 295 LEEAKFINLSLTSLGKCIN 351 LEEAKFINLSLTSLGKCIN Sbjct: 372 LEEAKFINLSLTSLGKCIN 390 Score = 57.0 bits (136), Expect = 2e-06 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 6 GSFTVEISYLQLYLESVQDLLLPEKNNIPIVEDPKTG 116 GS VE+SYLQLY+ES+QDLL PEK NIPI ED +TG Sbjct: 227 GSDIVEVSYLQLYMESIQDLLAPEKINIPINEDARTG 263 >ref|XP_002311994.1| predicted protein [Populus trichocarpa] gi|222851814|gb|EEE89361.1| predicted protein [Populus trichocarpa] Length = 415 Score = 101 bits (252), Expect = 6e-20 Identities = 50/79 (63%), Positives = 62/79 (78%) Frame = +1 Query: 115 VYIHKNSQGKAGSEPSSLARDTKIGVPVQNGVATILKSKLLIVDLAGSERIDKSGSEGHM 294 V++ ++ KAG E +S +D K + NG+ + KSKLL+VDLAGSER+DKSGSEGH+ Sbjct: 247 VHVRRSINQKAGDETASQEKDVKSNLAGGNGLPRVRKSKLLVVDLAGSERLDKSGSEGHL 306 Query: 295 LEEAKFINLSLTSLGKCIN 351 LEEAKFINLSLTSLGKCIN Sbjct: 307 LEEAKFINLSLTSLGKCIN 325 Score = 56.6 bits (135), Expect = 2e-06 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = +3 Query: 3 PGSFTVEISYLQLYLESVQDLLLPEKNNIPIVEDPKTG 116 PGS VE+SYL LY+ES+QDLL PEK +IPI ED +TG Sbjct: 161 PGSDVVEVSYLHLYMESIQDLLAPEKASIPINEDARTG 198 >ref|XP_002529601.1| Kinesin-II 85 kDa subunit, putative [Ricinus communis] gi|223530934|gb|EEF32793.1| Kinesin-II 85 kDa subunit, putative [Ricinus communis] Length = 1051 Score = 98.2 bits (243), Expect = 6e-19 Identities = 50/79 (63%), Positives = 61/79 (77%) Frame = +1 Query: 115 VYIHKNSQGKAGSEPSSLARDTKIGVPVQNGVATILKSKLLIVDLAGSERIDKSGSEGHM 294 VY+ ++ K E +S +D+K +P NG+ + K KLLIVDLAGSER+DKSGSEGH+ Sbjct: 279 VYVRRSIHQKLEDETTS--QDSKSDLPSSNGIPRVRKGKLLIVDLAGSERLDKSGSEGHL 336 Query: 295 LEEAKFINLSLTSLGKCIN 351 LEEAKFINLSLTSLGKCIN Sbjct: 337 LEEAKFINLSLTSLGKCIN 355 Score = 58.5 bits (140), Expect = 5e-07 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = +3 Query: 3 PGSFTVEISYLQLYLESVQDLLLPEKNNIPIVEDPKTG 116 P + VE+SYLQLY+ES+QDLL PEK NIPI EDP+TG Sbjct: 193 PDTDVVEMSYLQLYMESIQDLLAPEKINIPINEDPRTG 230 >ref|XP_002273191.2| PREDICTED: armadillo repeat-containing kinesin-like protein 1-like [Vitis vinifera] Length = 1017 Score = 92.0 bits (227), Expect = 4e-17 Identities = 48/79 (60%), Positives = 58/79 (73%) Frame = +1 Query: 115 VYIHKNSQGKAGSEPSSLARDTKIGVPVQNGVATILKSKLLIVDLAGSERIDKSGSEGHM 294 VY+ ++ K E SS + + VP + + + KSKLLIVDLAGSER+DKSGSEG + Sbjct: 266 VYVRRSVHKKVEDEISSQEKVNRSDVPGGSRIPIVRKSKLLIVDLAGSERVDKSGSEGQL 325 Query: 295 LEEAKFINLSLTSLGKCIN 351 LEEAKFINLSLTSLGKCIN Sbjct: 326 LEEAKFINLSLTSLGKCIN 344 Score = 60.8 bits (146), Expect = 1e-07 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = +3 Query: 3 PGSFTVEISYLQLYLESVQDLLLPEKNNIPIVEDPKTG 116 P S +VEISY+QLY+ES+QDLL PEK NIPI EDP+TG Sbjct: 180 PTSDSVEISYVQLYMESIQDLLAPEKINIPITEDPRTG 217 >emb|CBI31422.3| unnamed protein product [Vitis vinifera] Length = 1331 Score = 92.0 bits (227), Expect = 4e-17 Identities = 48/79 (60%), Positives = 58/79 (73%) Frame = +1 Query: 115 VYIHKNSQGKAGSEPSSLARDTKIGVPVQNGVATILKSKLLIVDLAGSERIDKSGSEGHM 294 VY+ ++ K E SS + + VP + + + KSKLLIVDLAGSER+DKSGSEG + Sbjct: 237 VYVRRSVHKKVEDEISSQEKVNRSDVPGGSRIPIVRKSKLLIVDLAGSERVDKSGSEGQL 296 Query: 295 LEEAKFINLSLTSLGKCIN 351 LEEAKFINLSLTSLGKCIN Sbjct: 297 LEEAKFINLSLTSLGKCIN 315 Score = 60.8 bits (146), Expect = 1e-07 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = +3 Query: 3 PGSFTVEISYLQLYLESVQDLLLPEKNNIPIVEDPKTG 116 P S +VEISY+QLY+ES+QDLL PEK NIPI EDP+TG Sbjct: 151 PTSDSVEISYVQLYMESIQDLLAPEKINIPITEDPRTG 188