BLASTX nr result
ID: Coptis25_contig00039089
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00039089 (404 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002538611.1| conserved hypothetical protein [Ricinus comm... 60 2e-07 >ref|XP_002538611.1| conserved hypothetical protein [Ricinus communis] gi|223511360|gb|EEF23772.1| conserved hypothetical protein [Ricinus communis] Length = 232 Score = 60.1 bits (144), Expect = 2e-07 Identities = 36/86 (41%), Positives = 46/86 (53%), Gaps = 4/86 (4%) Frame = +3 Query: 153 MPRKGMRSVFFH----SQXXXXXXXXXXXXXXXXXXXPVYTFSERMISDSLIVAEEMINK 320 MPRKGMRS+ F+ S P +FSE ++ +L A MI K Sbjct: 1 MPRKGMRSLCFNPKTPSFSVSPRSSPSRGSELSSSTTPRRSFSESVMEQTLETAAAMIMK 60 Query: 321 WNPDTSIYSNVTYLFQENRREAKDFI 398 WNPDTS Y++VT LF EN+REA F+ Sbjct: 61 WNPDTSNYASVTSLFYENKREALQFL 86