BLASTX nr result
ID: Coptis25_contig00038775
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00038775 (250 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002527799.1| conserved hypothetical protein [Ricinus comm... 74 2e-11 ref|XP_002515665.1| conserved hypothetical protein [Ricinus comm... 57 2e-06 >ref|XP_002527799.1| conserved hypothetical protein [Ricinus communis] gi|223532834|gb|EEF34609.1| conserved hypothetical protein [Ricinus communis] Length = 231 Score = 73.6 bits (179), Expect = 2e-11 Identities = 31/53 (58%), Positives = 43/53 (81%) Frame = +2 Query: 65 FLAFCRHHRKNRAFYAKRIPCNVVMMNSDGEMDILNKLPMIDNGDNTPGDSPA 223 ++ F RH +K+R F+AKRIPCN+V+MN +GE D++ PMIDNG+ TPG+SPA Sbjct: 159 WVIFDRHQKKDREFFAKRIPCNMVVMNENGEADMIRGQPMIDNGEFTPGESPA 211 >ref|XP_002515665.1| conserved hypothetical protein [Ricinus communis] gi|223545208|gb|EEF46717.1| conserved hypothetical protein [Ricinus communis] Length = 245 Score = 57.0 bits (136), Expect = 2e-06 Identities = 26/52 (50%), Positives = 37/52 (71%) Frame = +2 Query: 65 FLAFCRHHRKNRAFYAKRIPCNVVMMNSDGEMDILNKLPMIDNGDNTPGDSP 220 F+ RH RKN+AF+A+R+P +VVMM S G++D+L ID+ + TPG SP Sbjct: 174 FVVLDRHLRKNKAFFAQRLPSSVVMMKSGGDVDMLKIRSSIDSSELTPGKSP 225