BLASTX nr result
ID: Coptis25_contig00038515
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00038515 (258 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511848.1| conserved hypothetical protein [Ricinus comm... 92 6e-17 ref|XP_002273844.1| PREDICTED: UPF0187 protein At3g61320, chloro... 89 5e-16 ref|NP_182111.1| Bestrophin-like protein [Arabidopsis thaliana] ... 81 1e-13 ref|XP_002880204.1| hypothetical protein ARALYDRAFT_483727 [Arab... 80 2e-13 ref|XP_003529947.1| PREDICTED: UPF0187 protein At3g61320, chloro... 78 7e-13 >ref|XP_002511848.1| conserved hypothetical protein [Ricinus communis] gi|223549028|gb|EEF50517.1| conserved hypothetical protein [Ricinus communis] Length = 417 Score = 91.7 bits (226), Expect = 6e-17 Identities = 45/65 (69%), Positives = 52/65 (80%), Gaps = 2/65 (3%) Frame = +2 Query: 68 IKTLCSQSPTPTPISSLTLN--SILRIIPDWADGIKERRMQQKRSLYNHEDWVQHRSSLR 241 +KTLCS+ P P P +LTL S+LR IPDW+D IKER MQQKR+LYNH WV+HRSSLR Sbjct: 48 LKTLCSKPP-PNPHKTLTLTLISLLRAIPDWSDRIKERGMQQKRTLYNHNKWVEHRSSLR 106 Query: 242 HLRHL 256 HLRHL Sbjct: 107 HLRHL 111 >ref|XP_002273844.1| PREDICTED: UPF0187 protein At3g61320, chloroplastic [Vitis vinifera] Length = 419 Score = 88.6 bits (218), Expect = 5e-16 Identities = 40/55 (72%), Positives = 45/55 (81%) Frame = +2 Query: 92 PTPTPISSLTLNSILRIIPDWADGIKERRMQQKRSLYNHEDWVQHRSSLRHLRHL 256 P P+ +LTL SILR +PDWAD IKER MQQKRSLYNHE WV+HRSS RH+RHL Sbjct: 52 PPPSSTQNLTLISILRTVPDWADAIKERGMQQKRSLYNHETWVEHRSSRRHVRHL 106 >ref|NP_182111.1| Bestrophin-like protein [Arabidopsis thaliana] gi|20140947|sp|O80832.1|YU87_ARATH RecName: Full=UPF0187 protein At2g45870, chloroplastic; Flags: Precursor gi|3386607|gb|AAC28537.1| hypothetical protein [Arabidopsis thaliana] gi|18491251|gb|AAL69450.1| At2g45870/F4I18.15 [Arabidopsis thaliana] gi|330255518|gb|AEC10612.1| Bestrophin-like protein [Arabidopsis thaliana] Length = 410 Score = 80.9 bits (198), Expect = 1e-13 Identities = 36/52 (69%), Positives = 46/52 (88%) Frame = +2 Query: 101 TPISSLTLNSILRIIPDWADGIKERRMQQKRSLYNHEDWVQHRSSLRHLRHL 256 +P+S L S+L+ +P+W+DGIKERRMQQKRSLY HE+WV+HRSSLRHLRH+ Sbjct: 53 SPLSE-KLISLLKAVPNWSDGIKERRMQQKRSLYTHENWVRHRSSLRHLRHV 103 >ref|XP_002880204.1| hypothetical protein ARALYDRAFT_483727 [Arabidopsis lyrata subsp. lyrata] gi|297326043|gb|EFH56463.1| hypothetical protein ARALYDRAFT_483727 [Arabidopsis lyrata subsp. lyrata] Length = 411 Score = 79.7 bits (195), Expect = 2e-13 Identities = 35/52 (67%), Positives = 46/52 (88%) Frame = +2 Query: 101 TPISSLTLNSILRIIPDWADGIKERRMQQKRSLYNHEDWVQHRSSLRHLRHL 256 +P+S L S+L+ +P+W+DGIKERRM+QKRSLY HE+WV+HRSSLRHLRH+ Sbjct: 53 SPLSE-KLISLLKAVPNWSDGIKERRMEQKRSLYTHENWVRHRSSLRHLRHV 103 >ref|XP_003529947.1| PREDICTED: UPF0187 protein At3g61320, chloroplastic-like [Glycine max] Length = 413 Score = 78.2 bits (191), Expect = 7e-13 Identities = 36/60 (60%), Positives = 45/60 (75%) Frame = +2 Query: 77 LCSQSPTPTPISSLTLNSILRIIPDWADGIKERRMQQKRSLYNHEDWVQHRSSLRHLRHL 256 L S P PT + TL S+LR IPDWAD ++ER MQ+KR+LY H++W HRSSLRHLRH+ Sbjct: 46 LASFPPGPTSGPAQTLISLLRSIPDWADAVQERGMQKKRALYTHQNWRDHRSSLRHLRHV 105