BLASTX nr result
ID: Coptis25_contig00038482
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00038482 (381 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002283569.1| PREDICTED: uncharacterized protein At5g50100... 56 3e-06 >ref|XP_002283569.1| PREDICTED: uncharacterized protein At5g50100, mitochondrial [Vitis vinifera] gi|297733833|emb|CBI15080.3| unnamed protein product [Vitis vinifera] Length = 215 Score = 55.8 bits (133), Expect = 3e-06 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = +2 Query: 2 AVYGFWAKYRMQITGRPPLEDVFEARRKNRL 94 AVYG WAKYR+QITGRPPLE+V E R+KN++ Sbjct: 174 AVYGVWAKYRLQITGRPPLEEVLELRKKNKV 204