BLASTX nr result
ID: Coptis25_contig00038408
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00038408 (323 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_004222249.1| hypothetical protein BevumaM_p010 [Beta vulg... 140 8e-32 ref|YP_173490.1| hypothetical protein NitaMp153 [Nicotiana tabac... 114 8e-24 >ref|YP_004222249.1| hypothetical protein BevumaM_p010 [Beta vulgaris subsp. maritima] gi|346683127|ref|YP_004842056.1| hypothetical protein BemaM_p008 [Beta macrocarpa] gi|317905687|emb|CBX33234.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|319439767|emb|CBX33286.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|320147999|emb|CBJ20665.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|345500045|emb|CBX24861.1| hypothetical protein [Beta macrocarpa] gi|384939224|emb|CBL52070.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] Length = 145 Score = 140 bits (354), Expect = 8e-32 Identities = 72/88 (81%), Positives = 75/88 (85%), Gaps = 2/88 (2%) Frame = -2 Query: 322 WITGTNVVEWDSRRVTRSTVPRCEVQVVMITPGYALAPLTGTPGPANARENP--GRSSIH 149 WI GTNVV+WDS+RVTRSTVPRCEVQVVMITPGYALAPLTGTPGPANARENP GRSSI Sbjct: 60 WIRGTNVVKWDSKRVTRSTVPRCEVQVVMITPGYALAPLTGTPGPANARENPGLGRSSIL 119 Query: 148 PTGGVDNEATFTTFXXXXXXXSKIGRFA 65 PTG VDNEATFTTF K+GRFA Sbjct: 120 PTGDVDNEATFTTF--SLLSLYKVGRFA 145 >ref|YP_173490.1| hypothetical protein NitaMp153 [Nicotiana tabacum] gi|56806655|dbj|BAD83556.1| hypothetical protein (mitochondrion) [Nicotiana tabacum] Length = 109 Score = 114 bits (285), Expect = 8e-24 Identities = 53/58 (91%), Positives = 55/58 (94%) Frame = -2 Query: 322 WITGTNVVEWDSRRVTRSTVPRCEVQVVMITPGYALAPLTGTPGPANARENPGRSSIH 149 WI GTNVVEW+SRRVTRSTVPRCEVQVVMITPGYALAPLTGTP PANARENPGRS +H Sbjct: 45 WIKGTNVVEWNSRRVTRSTVPRCEVQVVMITPGYALAPLTGTPEPANARENPGRSVLH 102