BLASTX nr result
ID: Coptis25_contig00038182
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00038182 (361 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI21049.3| unnamed protein product [Vitis vinifera] 81 8e-14 ref|NP_194956.1| Core-2/I-branching beta-1,6-N-acetylglucosaminy... 67 2e-09 ref|XP_002867248.1| hypothetical protein ARALYDRAFT_491501 [Arab... 67 2e-09 ref|XP_002515506.1| conserved hypothetical protein [Ricinus comm... 67 2e-09 ref|NP_197915.1| Core-2/I-branching beta-1,6-N-acetylglucosaminy... 63 3e-08 >emb|CBI21049.3| unnamed protein product [Vitis vinifera] Length = 377 Score = 81.3 bits (199), Expect = 8e-14 Identities = 34/52 (65%), Positives = 46/52 (88%) Frame = +3 Query: 165 LPQDDKSLFRLASRVHPNPSPSNAPKRIAFMFLTTSPLPFAPLWELFFHSNY 320 +P+DDKSLFR+A+RV+P PSP A K++AFMFLTT+PL FAPLWE++F+S + Sbjct: 65 VPEDDKSLFRVAARVNPKPSPPGAAKKLAFMFLTTTPLAFAPLWEIYFNSTH 116 >ref|NP_194956.1| Core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family protein [Arabidopsis thaliana] gi|2864614|emb|CAA16961.1| putative protein [Arabidopsis thaliana] gi|7270133|emb|CAB79947.1| putative protein [Arabidopsis thaliana] gi|110737217|dbj|BAF00556.1| hypothetical protein [Arabidopsis thaliana] gi|119360161|gb|ABL66809.1| At4g32290 [Arabidopsis thaliana] gi|332660635|gb|AEE86035.1| Core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family protein [Arabidopsis thaliana] Length = 384 Score = 67.0 bits (162), Expect = 2e-09 Identities = 30/48 (62%), Positives = 40/48 (83%) Frame = +3 Query: 165 LPQDDKSLFRLASRVHPNPSPSNAPKRIAFMFLTTSPLPFAPLWELFF 308 +P++D L RL+SRV+PN P + ++IAFM+LTTSPLPFAPLWE+FF Sbjct: 68 IPKEDDPLLRLSSRVNPNLPPGST-RKIAFMYLTTSPLPFAPLWEMFF 114 >ref|XP_002867248.1| hypothetical protein ARALYDRAFT_491501 [Arabidopsis lyrata subsp. lyrata] gi|297313084|gb|EFH43507.1| hypothetical protein ARALYDRAFT_491501 [Arabidopsis lyrata subsp. lyrata] Length = 385 Score = 67.0 bits (162), Expect = 2e-09 Identities = 30/49 (61%), Positives = 41/49 (83%) Frame = +3 Query: 165 LPQDDKSLFRLASRVHPNPSPSNAPKRIAFMFLTTSPLPFAPLWELFFH 311 +P++D+ L RLASRV+PN P + +++AFM+LTTSPLPFAPLWE FF+ Sbjct: 68 IPKEDEPLLRLASRVNPNLPPGST-RKLAFMYLTTSPLPFAPLWEKFFN 115 >ref|XP_002515506.1| conserved hypothetical protein [Ricinus communis] gi|223545450|gb|EEF46955.1| conserved hypothetical protein [Ricinus communis] Length = 391 Score = 66.6 bits (161), Expect = 2e-09 Identities = 32/47 (68%), Positives = 38/47 (80%) Frame = +3 Query: 168 PQDDKSLFRLASRVHPNPSPSNAPKRIAFMFLTTSPLPFAPLWELFF 308 PQDD+SL R ASRV+P P PK+IAF+FLTT+PL FAPLWEL+F Sbjct: 83 PQDDQSLLRSASRVNPRPL---LPKKIAFLFLTTTPLHFAPLWELYF 126 >ref|NP_197915.1| Core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family protein [Arabidopsis thaliana] gi|71143072|gb|AAZ23927.1| At5g25330 [Arabidopsis thaliana] gi|332006044|gb|AED93427.1| Core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family protein [Arabidopsis thaliana] Length = 366 Score = 62.8 bits (151), Expect = 3e-08 Identities = 29/47 (61%), Positives = 37/47 (78%) Frame = +3 Query: 177 DKSLFRLASRVHPNPSPSNAPKRIAFMFLTTSPLPFAPLWELFFHSN 317 D+ L R AS+ +PNPSP PK++AFMFLTT+ LP APLWELFF+ + Sbjct: 60 DELLLRQASKANPNPSPK-FPKKLAFMFLTTNSLPLAPLWELFFNQS 105