BLASTX nr result
ID: Coptis25_contig00038051
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00038051 (548 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004160609.1| PREDICTED: 26S proteasome non-ATPase regulat... 58 8e-07 ref|XP_004141249.1| PREDICTED: 26S proteasome non-ATPase regulat... 58 8e-07 gb|AFK36477.1| unknown [Medicago truncatula] 58 8e-07 ref|XP_003544454.1| PREDICTED: 26S proteasome non-ATPase regulat... 58 8e-07 ref|XP_003542979.1| PREDICTED: 26S proteasome non-ATPase regulat... 58 8e-07 >ref|XP_004160609.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 14-like [Cucumis sativus] Length = 309 Score = 58.2 bits (139), Expect = 8e-07 Identities = 34/81 (41%), Positives = 40/81 (49%) Frame = -2 Query: 271 VHVYVFHLIHPLTMMIGQEPRHTASSLGHLKIPPF*VNTSLIVKSLSMNANLFSYIYDLL 92 V + F LI+P TMM+GQEPR T S+LGHL P Sbjct: 155 VVIDAFRLINPQTMMLGQEPRQTTSNLGHLNKPSI------------------------- 189 Query: 91 YQAFIHGLSKDYYSIPINYMK 29 QA IHGL++ YYSI INY K Sbjct: 190 -QALIHGLNRHYYSIAINYRK 209 >ref|XP_004141249.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 14-like [Cucumis sativus] gi|449498695|ref|XP_004160608.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 14-like [Cucumis sativus] Length = 309 Score = 58.2 bits (139), Expect = 8e-07 Identities = 34/81 (41%), Positives = 40/81 (49%) Frame = -2 Query: 271 VHVYVFHLIHPLTMMIGQEPRHTASSLGHLKIPPF*VNTSLIVKSLSMNANLFSYIYDLL 92 V + F LI+P TMM+GQEPR T S+LGHL P Sbjct: 155 VVIDAFRLINPQTMMLGQEPRQTTSNLGHLNKPSI------------------------- 189 Query: 91 YQAFIHGLSKDYYSIPINYMK 29 QA IHGL++ YYSI INY K Sbjct: 190 -QALIHGLNRHYYSIAINYRK 209 >gb|AFK36477.1| unknown [Medicago truncatula] Length = 313 Score = 58.2 bits (139), Expect = 8e-07 Identities = 34/81 (41%), Positives = 40/81 (49%) Frame = -2 Query: 271 VHVYVFHLIHPLTMMIGQEPRHTASSLGHLKIPPF*VNTSLIVKSLSMNANLFSYIYDLL 92 V + F LI+P TMM+GQEPR T S+LGHL P Sbjct: 159 VVIDAFRLINPQTMMLGQEPRQTTSNLGHLNKPSI------------------------- 193 Query: 91 YQAFIHGLSKDYYSIPINYMK 29 QA IHGL++ YYSI INY K Sbjct: 194 -QALIHGLNRHYYSIAINYRK 213 >ref|XP_003544454.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 14-like [Glycine max] gi|356564198|ref|XP_003550343.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 14-like [Glycine max] Length = 312 Score = 58.2 bits (139), Expect = 8e-07 Identities = 34/81 (41%), Positives = 40/81 (49%) Frame = -2 Query: 271 VHVYVFHLIHPLTMMIGQEPRHTASSLGHLKIPPF*VNTSLIVKSLSMNANLFSYIYDLL 92 V + F LI+P TMM+GQEPR T S+LGHL P Sbjct: 158 VVIDAFRLINPQTMMLGQEPRQTTSNLGHLNKPSI------------------------- 192 Query: 91 YQAFIHGLSKDYYSIPINYMK 29 QA IHGL++ YYSI INY K Sbjct: 193 -QALIHGLNRHYYSIAINYRK 212 >ref|XP_003542979.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 14-like [Glycine max] Length = 309 Score = 58.2 bits (139), Expect = 8e-07 Identities = 34/81 (41%), Positives = 40/81 (49%) Frame = -2 Query: 271 VHVYVFHLIHPLTMMIGQEPRHTASSLGHLKIPPF*VNTSLIVKSLSMNANLFSYIYDLL 92 V + F LI+P TMM+GQEPR T S+LGHL P Sbjct: 155 VVIDAFRLINPQTMMLGQEPRQTTSNLGHLNKPSI------------------------- 189 Query: 91 YQAFIHGLSKDYYSIPINYMK 29 QA IHGL++ YYSI INY K Sbjct: 190 -QALIHGLNRHYYSIAINYRK 209