BLASTX nr result
ID: Coptis25_contig00038026
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00038026 (277 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002263186.2| PREDICTED: LRR receptor-like serine/threonin... 63 2e-08 ref|XP_002263151.2| PREDICTED: LRR receptor-like serine/threonin... 55 8e-06 >ref|XP_002263186.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase HSL2-like [Vitis vinifera] Length = 657 Score = 63.2 bits (152), Expect = 2e-08 Identities = 31/64 (48%), Positives = 41/64 (64%), Gaps = 2/64 (3%) Frame = -3 Query: 266 LCSPDLKPFPPCLKTKASTWFLI--WAIFCLSLAVLVFWFVKTKRRTIDGKRLLPWKLTS 93 LCSP+LKP PPC ++K +T +LI AIF L L +FWF+KT+ + GKR WK T Sbjct: 286 LCSPNLKPLPPCSRSKPATLYLIGVLAIFTLILLGSLFWFLKTRSKIFGGKRKGQWKTTI 345 Query: 92 FHRL 81 F + Sbjct: 346 FQSI 349 >ref|XP_002263151.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase HSL2-like [Vitis vinifera] Length = 978 Score = 54.7 bits (130), Expect = 8e-06 Identities = 26/65 (40%), Positives = 38/65 (58%), Gaps = 3/65 (4%) Frame = -3 Query: 266 LCSPDLKPFPPCLKTKASTWFLIWAIFCLSLAVL---VFWFVKTKRRTIDGKRLLPWKLT 96 LCSP+LKP PPC ++K T +LI + +L +L +FWF+KT+ + K WK T Sbjct: 606 LCSPNLKPLPPCSRSKPITLYLIGVLAIFTLILLLGSLFWFLKTRSKIFGDKPNRQWKTT 665 Query: 95 SFHRL 81 F + Sbjct: 666 IFQSI 670