BLASTX nr result
ID: Coptis25_contig00038014
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00038014 (332 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002523781.1| pentatricopeptide repeat-containing protein,... 57 2e-06 >ref|XP_002523781.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223536869|gb|EEF38507.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 661 Score = 56.6 bits (135), Expect = 2e-06 Identities = 36/95 (37%), Positives = 52/95 (54%), Gaps = 13/95 (13%) Frame = +2 Query: 86 KPDPINPDIITTVLLDFL-------NVDEPSNAPQ------PFDEIPQGNLPMCYYSLLL 226 KP PI + T FL N+ +P P+ FD P+ ++ C + LL Sbjct: 13 KPQPIQ--FLKTTRTQFLQSHATAVNLGKPLQEPKCSIAQNVFDRSPKQDVVQCNH-LLF 69 Query: 227 EHSRNNLHHKVLDVFSKIHQSDGFIDGSGLTCVLK 331 ++SRNN HH+V+++F IH+SD DGS L+CVLK Sbjct: 70 DYSRNNSHHEVVNLFVAIHRSDLLTDGSTLSCVLK 104