BLASTX nr result
ID: Coptis25_contig00037891
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00037891 (202 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002520932.1| pentatricopeptide repeat-containing protein,... 90 2e-16 ref|XP_002886104.1| pentatricopeptide repeat-containing protein ... 81 8e-14 sp|Q9SII7.2|PP159_ARATH RecName: Full=Pentatricopeptide repeat-c... 79 5e-13 ref|NP_179312.1| pentatricopeptide repeat-containing protein [Ar... 79 5e-13 ref|XP_004168522.1| PREDICTED: pentatricopeptide repeat-containi... 77 1e-12 >ref|XP_002520932.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223539898|gb|EEF41477.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 757 Score = 90.1 bits (222), Expect = 2e-16 Identities = 40/67 (59%), Positives = 54/67 (80%) Frame = +1 Query: 1 NFYMKCGDINSALSVFACMVNKDSVSWNIVIHGCLDSGPYKEGLCMFVKARGQVFEPNVS 180 NFY+KCG++++A+SVF M ++DSVSWN++IHGCLD G EGL F+ AR FEPN+S Sbjct: 107 NFYIKCGELDTAVSVFDSMRSRDSVSWNVLIHGCLDYGALVEGLWQFINARVAGFEPNIS 166 Query: 181 TLVLVLQ 201 TLVL++Q Sbjct: 167 TLVLLVQ 173 >ref|XP_002886104.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297331944|gb|EFH62363.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 723 Score = 81.3 bits (199), Expect = 8e-14 Identities = 39/66 (59%), Positives = 48/66 (72%) Frame = +1 Query: 1 NFYMKCGDINSALSVFACMVNKDSVSWNIVIHGCLDSGPYKEGLCMFVKARGQVFEPNVS 180 +FYMKCGD+ S L F CM ++DSVSWN+++ G LD G +EGL F K R FEPNVS Sbjct: 77 DFYMKCGDLCSGLRAFDCMNSRDSVSWNVIVFGLLDHGFEEEGLWWFSKLRVWGFEPNVS 136 Query: 181 TLVLVL 198 TLVLV+ Sbjct: 137 TLVLVI 142 >sp|Q9SII7.2|PP159_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At2g17210 Length = 736 Score = 78.6 bits (192), Expect = 5e-13 Identities = 38/66 (57%), Positives = 47/66 (71%) Frame = +1 Query: 1 NFYMKCGDINSALSVFACMVNKDSVSWNIVIHGCLDSGPYKEGLCMFVKARGQVFEPNVS 180 +FYMKCGD+ S L F CM ++DSVSWN+++ G LD G +EGL F K R FEPN S Sbjct: 90 DFYMKCGDLCSGLREFDCMNSRDSVSWNVIVFGLLDYGFEEEGLWWFSKLRVWGFEPNTS 149 Query: 181 TLVLVL 198 TLVLV+ Sbjct: 150 TLVLVI 155 >ref|NP_179312.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|4584344|gb|AAD25139.1| putative selenium-binding protein [Arabidopsis thaliana] gi|330251504|gb|AEC06598.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 715 Score = 78.6 bits (192), Expect = 5e-13 Identities = 38/66 (57%), Positives = 47/66 (71%) Frame = +1 Query: 1 NFYMKCGDINSALSVFACMVNKDSVSWNIVIHGCLDSGPYKEGLCMFVKARGQVFEPNVS 180 +FYMKCGD+ S L F CM ++DSVSWN+++ G LD G +EGL F K R FEPN S Sbjct: 69 DFYMKCGDLCSGLREFDCMNSRDSVSWNVIVFGLLDYGFEEEGLWWFSKLRVWGFEPNTS 128 Query: 181 TLVLVL 198 TLVLV+ Sbjct: 129 TLVLVI 134 >ref|XP_004168522.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17210-like [Cucumis sativus] Length = 747 Score = 77.0 bits (188), Expect = 1e-12 Identities = 34/67 (50%), Positives = 47/67 (70%) Frame = +1 Query: 1 NFYMKCGDINSALSVFACMVNKDSVSWNIVIHGCLDSGPYKEGLCMFVKARGQVFEPNVS 180 +FYMK GD++SA F NKDSVSWN+++HG +G GLC F+K R F+PN+S Sbjct: 90 DFYMKYGDLDSAQRAFDSTKNKDSVSWNVMVHGNFSNGSIMAGLCWFIKGRFAHFQPNIS 149 Query: 181 TLVLVLQ 201 +L+LV+Q Sbjct: 150 SLLLVIQ 156