BLASTX nr result
ID: Coptis25_contig00037788
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00037788 (316 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN78447.1| hypothetical protein VITISV_026810 [Vitis vinifera] 56 3e-06 >emb|CAN78447.1| hypothetical protein VITISV_026810 [Vitis vinifera] Length = 1171 Score = 56.2 bits (134), Expect = 3e-06 Identities = 22/42 (52%), Positives = 31/42 (73%) Frame = -3 Query: 134 PGNIPICQICGKVGHYDIDCYDRMNFAF*GKIPPRTLKAIVA 9 P N P+CQICGK GH IDC+ R ++++ G+ PP+ L A+VA Sbjct: 269 PNNRPVCQICGKSGHTAIDCFHRFDYSYQGRFPPQDLAAMVA 310