BLASTX nr result
ID: Coptis25_contig00037718
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00037718 (298 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI35029.3| unnamed protein product [Vitis vinifera] 124 8e-27 ref|XP_002276684.1| PREDICTED: putative pentatricopeptide repeat... 124 8e-27 ref|NP_189505.2| pentatricopeptide repeat-containing protein [Ar... 121 5e-26 ref|NP_189507.2| pentatricopeptide repeat-containing protein [Ar... 119 3e-25 ref|XP_002877120.1| pentatricopeptide repeat-containing protein ... 119 3e-25 >emb|CBI35029.3| unnamed protein product [Vitis vinifera] Length = 1596 Score = 124 bits (311), Expect = 8e-27 Identities = 60/94 (63%), Positives = 70/94 (74%) Frame = +2 Query: 17 RKVFDEIHERDVFQWNVFMNGCLRYGMDVEALSAFRDMLSSGVELDEYCVATGLTACAHS 196 RK+FDEI DV QWNV +NG +R G+ EAL+AFR+ML SGVE DE+C+ T L CA Sbjct: 161 RKLFDEIPNLDVVQWNVLLNGYVRRGLAPEALNAFRNMLVSGVEPDEFCLTTALKGCAQL 220 Query: 197 GALRQGMWIHEYVKKRDEFSEDVFVGTALVDMYA 298 GAL+QG WIHEYV KR DVF+GTALVDMYA Sbjct: 221 GALQQGKWIHEYVTKRKWLEADVFIGTALVDMYA 254 >ref|XP_002276684.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g28640-like [Vitis vinifera] Length = 511 Score = 124 bits (311), Expect = 8e-27 Identities = 60/94 (63%), Positives = 70/94 (74%) Frame = +2 Query: 17 RKVFDEIHERDVFQWNVFMNGCLRYGMDVEALSAFRDMLSSGVELDEYCVATGLTACAHS 196 RK+FDEI DV QWNV +NG +R G+ EAL+AFR+ML SGVE DE+C+ T L CA Sbjct: 161 RKLFDEIPNLDVVQWNVLLNGYVRRGLAPEALNAFRNMLVSGVEPDEFCLTTALKGCAQL 220 Query: 197 GALRQGMWIHEYVKKRDEFSEDVFVGTALVDMYA 298 GAL+QG WIHEYV KR DVF+GTALVDMYA Sbjct: 221 GALQQGKWIHEYVTKRKWLEADVFIGTALVDMYA 254 >ref|NP_189505.2| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75273576|sp|Q9LJJ1.1|PP259_ARATH RecName: Full=Putative pentatricopeptide repeat-containing protein At3g28640 gi|9294278|dbj|BAB02180.1| unnamed protein product [Arabidopsis thaliana] gi|332643948|gb|AEE77469.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 504 Score = 121 bits (304), Expect = 5e-26 Identities = 59/98 (60%), Positives = 71/98 (72%) Frame = +2 Query: 5 LVEFRKVFDEIHERDVFQWNVFMNGCLRYGMDVEALSAFRDMLSSGVELDEYCVATGLTA 184 L++ RKVFDEI + DV +W+V MNG +R G+ E L FR+ML G+E DE+ V T LTA Sbjct: 168 LLDARKVFDEIPQPDVVKWDVLMNGYVRCGLGSEGLEVFREMLVKGLEPDEFSVTTALTA 227 Query: 185 CAHSGALRQGMWIHEYVKKRDEFSEDVFVGTALVDMYA 298 CA GAL QG WIHE+VKK+ DVFVGTALVDMYA Sbjct: 228 CAQVGALAQGKWIHEFVKKKSWIESDVFVGTALVDMYA 265 >ref|NP_189507.2| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75273574|sp|Q9LJI9.1|PP260_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At3g28660 gi|9294280|dbj|BAB02182.1| unnamed protein product [Arabidopsis thaliana] gi|20259531|gb|AAM13885.1| unknown protein [Arabidopsis thaliana] gi|24030460|gb|AAN41382.1| unknown protein [Arabidopsis thaliana] gi|332643950|gb|AEE77471.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 504 Score = 119 bits (298), Expect = 3e-25 Identities = 58/98 (59%), Positives = 70/98 (71%) Frame = +2 Query: 5 LVEFRKVFDEIHERDVFQWNVFMNGCLRYGMDVEALSAFRDMLSSGVELDEYCVATGLTA 184 L + RKVFDEI + DV +W+V MNG +R G+ E L F++ML G+E DE+ V T LTA Sbjct: 168 LFDARKVFDEIPQPDVVKWDVLMNGYVRCGLGSEGLEVFKEMLVRGIEPDEFSVTTALTA 227 Query: 185 CAHSGALRQGMWIHEYVKKRDEFSEDVFVGTALVDMYA 298 CA GAL QG WIHE+VKK+ DVFVGTALVDMYA Sbjct: 228 CAQVGALAQGKWIHEFVKKKRWIESDVFVGTALVDMYA 265 >ref|XP_002877120.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297322958|gb|EFH53379.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 399 Score = 119 bits (298), Expect = 3e-25 Identities = 59/98 (60%), Positives = 70/98 (71%) Frame = +2 Query: 5 LVEFRKVFDEIHERDVFQWNVFMNGCLRYGMDVEALSAFRDMLSSGVELDEYCVATGLTA 184 L++ KVFDEI + DV +W+V MNG +R G+ E L FR+ML GVE DE+ V T LTA Sbjct: 63 LLDAHKVFDEIPKPDVVKWDVLMNGYVRCGLGSEGLEVFREMLVRGVEPDEFSVTTALTA 122 Query: 185 CAHSGALRQGMWIHEYVKKRDEFSEDVFVGTALVDMYA 298 CA GAL QG WIHE+VKK+ DVFVGTALVDMYA Sbjct: 123 CAQVGALAQGKWIHEFVKKKRWIESDVFVGTALVDMYA 160