BLASTX nr result
ID: Coptis25_contig00037563
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00037563 (216 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004167566.1| PREDICTED: transcription factor ABORTED MICR... 54 1e-05 ref|XP_004135248.1| PREDICTED: transcription factor ABORTED MICR... 54 1e-05 >ref|XP_004167566.1| PREDICTED: transcription factor ABORTED MICROSPORES-like [Cucumis sativus] Length = 473 Score = 54.3 bits (129), Expect = 1e-05 Identities = 26/48 (54%), Positives = 36/48 (75%) Frame = +3 Query: 6 MEAMNALGLHVTEANIITVKGRVMNIFKAEAKTDDIQAQQLKDSLLKL 149 +EAM++LGL V + NI T G V+NIF EA +DIQ ++L+DSL+KL Sbjct: 424 IEAMDSLGLQVIDVNITTFGGMVLNIFHVEANENDIQPKRLRDSLIKL 471 >ref|XP_004135248.1| PREDICTED: transcription factor ABORTED MICROSPORES-like [Cucumis sativus] Length = 473 Score = 54.3 bits (129), Expect = 1e-05 Identities = 26/48 (54%), Positives = 36/48 (75%) Frame = +3 Query: 6 MEAMNALGLHVTEANIITVKGRVMNIFKAEAKTDDIQAQQLKDSLLKL 149 +EAM++LGL V + NI T G V+NIF EA +DIQ ++L+DSL+KL Sbjct: 424 IEAMDSLGLQVIDVNITTFGGMVLNIFHVEANENDIQPKRLRDSLIKL 471