BLASTX nr result
ID: Coptis25_contig00037542
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00037542 (412 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002279261.1| PREDICTED: uncharacterized protein YKR070W [... 88 8e-16 emb|CAN80293.1| hypothetical protein VITISV_032013 [Vitis vinifera] 88 8e-16 ref|XP_002530236.1| hydrolase, putative [Ricinus communis] gi|22... 87 1e-15 ref|XP_002281784.2| PREDICTED: uncharacterized protein YKR070W-l... 84 2e-14 ref|XP_002523931.1| hydrolase, putative [Ricinus communis] gi|22... 84 2e-14 >ref|XP_002279261.1| PREDICTED: uncharacterized protein YKR070W [Vitis vinifera] gi|296086087|emb|CBI31528.3| unnamed protein product [Vitis vinifera] Length = 373 Score = 87.8 bits (216), Expect = 8e-16 Identities = 42/46 (91%), Positives = 43/46 (93%) Frame = -1 Query: 139 KAAFPSERLGMGAFRIALESIFNRIHSKALEYTSLGKPNPFVFKNA 2 +AAFPSERLGMGAFRIALESIFNRIH ALEYTS GKPNPFVFKNA Sbjct: 238 QAAFPSERLGMGAFRIALESIFNRIHHNALEYTSFGKPNPFVFKNA 283 >emb|CAN80293.1| hypothetical protein VITISV_032013 [Vitis vinifera] Length = 345 Score = 87.8 bits (216), Expect = 8e-16 Identities = 42/46 (91%), Positives = 43/46 (93%) Frame = -1 Query: 139 KAAFPSERLGMGAFRIALESIFNRIHSKALEYTSLGKPNPFVFKNA 2 +AAFPSERLGMGAFRIALESIFNRIH ALEYTS GKPNPFVFKNA Sbjct: 233 QAAFPSERLGMGAFRIALESIFNRIHHNALEYTSFGKPNPFVFKNA 278 >ref|XP_002530236.1| hydrolase, putative [Ricinus communis] gi|223530240|gb|EEF32142.1| hydrolase, putative [Ricinus communis] Length = 382 Score = 87.4 bits (215), Expect = 1e-15 Identities = 41/46 (89%), Positives = 43/46 (93%) Frame = -1 Query: 139 KAAFPSERLGMGAFRIALESIFNRIHSKALEYTSLGKPNPFVFKNA 2 +AAFPSERLGMGAFRIALES+FNRIH K LEYTS GKPNPFVFKNA Sbjct: 245 QAAFPSERLGMGAFRIALESVFNRIHPKPLEYTSFGKPNPFVFKNA 290 >ref|XP_002281784.2| PREDICTED: uncharacterized protein YKR070W-like [Vitis vinifera] gi|297746180|emb|CBI16236.3| unnamed protein product [Vitis vinifera] Length = 382 Score = 83.6 bits (205), Expect = 2e-14 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = -1 Query: 139 KAAFPSERLGMGAFRIALESIFNRIHSKALEYTSLGKPNPFVFKNA 2 +AAFPSERLGMGAFRIALE+IFNRIH KALEYTS GKP+P VFKNA Sbjct: 243 QAAFPSERLGMGAFRIALEAIFNRIHPKALEYTSFGKPSPSVFKNA 288 >ref|XP_002523931.1| hydrolase, putative [Ricinus communis] gi|223536861|gb|EEF38500.1| hydrolase, putative [Ricinus communis] Length = 382 Score = 83.6 bits (205), Expect = 2e-14 Identities = 39/46 (84%), Positives = 42/46 (91%) Frame = -1 Query: 139 KAAFPSERLGMGAFRIALESIFNRIHSKALEYTSLGKPNPFVFKNA 2 +AAFPS+RLGMGAFRIALESIFNRIH ALEY + GKPNPFVFKNA Sbjct: 261 QAAFPSQRLGMGAFRIALESIFNRIHHNALEYVTFGKPNPFVFKNA 306