BLASTX nr result
ID: Coptis25_contig00037507
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00037507 (264 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002534747.1| conserved hypothetical protein [Ricinus comm... 124 8e-27 >ref|XP_002534747.1| conserved hypothetical protein [Ricinus communis] gi|255604001|ref|XP_002538152.1| conserved hypothetical protein [Ricinus communis] gi|223513575|gb|EEF24232.1| conserved hypothetical protein [Ricinus communis] gi|223524644|gb|EEF27638.1| conserved hypothetical protein [Ricinus communis] Length = 126 Score = 124 bits (311), Expect = 8e-27 Identities = 68/86 (79%), Positives = 70/86 (81%), Gaps = 6/86 (6%) Frame = -1 Query: 264 HSHSMEEQLLNPHYNQSKISPDRYMM-LNQDLDRERGLPLFGWLFETKALIGMVLIPMFL 88 HSHSMEEQLLNPHYNQS+ SPDRYMM LN+D DRERGLPL WLFE KALIGMVLIPMF Sbjct: 17 HSHSMEEQLLNPHYNQSQFSPDRYMMMLNRDQDRERGLPLC-WLFEAKALIGMVLIPMFF 75 Query: 87 LVSFGFESLPLPD-----AEVILDFF 25 LVSFGFESLPL VILDFF Sbjct: 76 LVSFGFESLPLHVLTRLLKAVILDFF 101