BLASTX nr result
ID: Coptis25_contig00037459
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00037459 (269 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003576319.1| PREDICTED: uncharacterized protein LOC100846... 55 8e-06 >ref|XP_003576319.1| PREDICTED: uncharacterized protein LOC100846030 [Brachypodium distachyon] Length = 497 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = +2 Query: 8 LYALPICFLWIVTAFQLGRRQTYLAKLQATSLP 106 LYALP+CFLW++TAF LGR QT LAKLQA S P Sbjct: 464 LYALPLCFLWLLTAFHLGRLQTNLAKLQAASDP 496