BLASTX nr result
ID: Coptis25_contig00037391
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00037391 (416 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003535577.1| PREDICTED: ABC transporter C family member 1... 63 3e-08 ref|XP_002331826.1| multidrug resistance protein ABC transporter... 63 3e-08 ref|XP_002266842.2| PREDICTED: ABC transporter C family member 1... 61 8e-08 ref|XP_003548999.1| PREDICTED: ABC transporter C family member 1... 61 8e-08 ref|XP_003592151.1| Multidrug resistance protein ABC transporter... 61 8e-08 >ref|XP_003535577.1| PREDICTED: ABC transporter C family member 10-like, partial [Glycine max] Length = 1509 Score = 62.8 bits (151), Expect = 3e-08 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +3 Query: 3 PQDPTLFNGTVRYNMDPLYQHTDLEIWEVLQ 95 PQDPTLFNGTVRYNMDPL QH+D EIWEVL+ Sbjct: 1344 PQDPTLFNGTVRYNMDPLSQHSDKEIWEVLR 1374 >ref|XP_002331826.1| multidrug resistance protein ABC transporter family [Populus trichocarpa] gi|222875064|gb|EEF12195.1| multidrug resistance protein ABC transporter family [Populus trichocarpa] Length = 1423 Score = 62.8 bits (151), Expect = 3e-08 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +3 Query: 3 PQDPTLFNGTVRYNMDPLYQHTDLEIWEVL 92 PQDPTLFNGTVRYN+DPL QHTD EIWEVL Sbjct: 1259 PQDPTLFNGTVRYNLDPLSQHTDQEIWEVL 1288 >ref|XP_002266842.2| PREDICTED: ABC transporter C family member 10-like [Vitis vinifera] Length = 1483 Score = 61.2 bits (147), Expect = 8e-08 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +3 Query: 3 PQDPTLFNGTVRYNMDPLYQHTDLEIWEVL 92 PQDPTLFNGTVRYN+DPL QHT+ EIWEVL Sbjct: 1318 PQDPTLFNGTVRYNLDPLSQHTEQEIWEVL 1347 >ref|XP_003548999.1| PREDICTED: ABC transporter C family member 10-like [Glycine max] Length = 1478 Score = 61.2 bits (147), Expect = 8e-08 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +3 Query: 3 PQDPTLFNGTVRYNMDPLYQHTDLEIWEVL 92 PQDPTLFNGTVRYN+DPL QH+D EIWEVL Sbjct: 1313 PQDPTLFNGTVRYNLDPLSQHSDQEIWEVL 1342 >ref|XP_003592151.1| Multidrug resistance protein ABC transporter family [Medicago truncatula] gi|355481199|gb|AES62402.1| Multidrug resistance protein ABC transporter family [Medicago truncatula] Length = 1516 Score = 61.2 bits (147), Expect = 8e-08 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +3 Query: 3 PQDPTLFNGTVRYNMDPLYQHTDLEIWEVL 92 PQDPTLFNGTVRYN+DPL QH+D EIWEVL Sbjct: 1351 PQDPTLFNGTVRYNLDPLSQHSDQEIWEVL 1380