BLASTX nr result
ID: Coptis25_contig00037211
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00037211 (397 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002313081.1| predicted protein [Populus trichocarpa] gi|2... 56 8e-08 ref|XP_004169112.1| PREDICTED: uncharacterized LOC101222694 [Cuc... 57 2e-06 ref|XP_004137126.1| PREDICTED: uncharacterized protein LOC101222... 57 2e-06 ref|XP_002284886.1| PREDICTED: uncharacterized protein LOC100262... 57 2e-06 ref|XP_002519153.1| conserved hypothetical protein [Ricinus comm... 56 3e-06 >ref|XP_002313081.1| predicted protein [Populus trichocarpa] gi|222849489|gb|EEE87036.1| predicted protein [Populus trichocarpa] Length = 510 Score = 55.8 bits (133), Expect(2) = 8e-08 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +1 Query: 238 LVKASEDSLLGQGLKVLDTSVENIASGAWQCL 333 L KASEDS+LGQGLKVLD SVEN+ASGAWQ L Sbjct: 112 LEKASEDSILGQGLKVLDHSVENLASGAWQAL 143 Score = 25.4 bits (54), Expect(2) = 8e-08 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = +2 Query: 314 QEHGNAWKGGSSFVHK 361 Q G+AWKGGS+ V K Sbjct: 141 QALGSAWKGGSNLVQK 156 >ref|XP_004169112.1| PREDICTED: uncharacterized LOC101222694 [Cucumis sativus] Length = 525 Score = 57.0 bits (136), Expect = 2e-06 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = +1 Query: 238 LVKASEDSLLGQGLKVLDTSVENIASGAWQCLERGLK 348 L KASEDS+ GQGLKVLDTSVENIASGAW+ L L+ Sbjct: 123 LEKASEDSVFGQGLKVLDTSVENIASGAWKALGSALR 159 >ref|XP_004137126.1| PREDICTED: uncharacterized protein LOC101222694 [Cucumis sativus] Length = 482 Score = 57.0 bits (136), Expect = 2e-06 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = +1 Query: 238 LVKASEDSLLGQGLKVLDTSVENIASGAWQCLERGLK 348 L KASEDS+ GQGLKVLDTSVENIASGAW+ L L+ Sbjct: 80 LEKASEDSVFGQGLKVLDTSVENIASGAWKALGSALR 116 >ref|XP_002284886.1| PREDICTED: uncharacterized protein LOC100262433 [Vitis vinifera] gi|297741363|emb|CBI32494.3| unnamed protein product [Vitis vinifera] Length = 510 Score = 57.0 bits (136), Expect = 2e-06 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = +1 Query: 232 DFLVKASEDSLLGQGLKVLDTSVENIASGAWQCL 333 D L KASEDS LGQGLKVLD SVEN+ASGAWQ L Sbjct: 110 DKLEKASEDSFLGQGLKVLDNSVENLASGAWQAL 143 >ref|XP_002519153.1| conserved hypothetical protein [Ricinus communis] gi|223541816|gb|EEF43364.1| conserved hypothetical protein [Ricinus communis] Length = 513 Score = 56.2 bits (134), Expect = 3e-06 Identities = 29/39 (74%), Positives = 30/39 (76%) Frame = +1 Query: 232 DFLVKASEDSLLGQGLKVLDTSVENIASGAWQCLERGLK 348 D L KASE+S LGQGLKVLD SVEN ASGAWQ L LK Sbjct: 111 DKLEKASEESFLGQGLKVLDHSVENFASGAWQALGSALK 149