BLASTX nr result
ID: Coptis25_contig00037052
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00037052 (333 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002515153.1| conserved hypothetical protein [Ricinus comm... 97 1e-18 ref|XP_002515154.1| conserved hypothetical protein [Ricinus comm... 94 9e-18 emb|CBI37035.3| unnamed protein product [Vitis vinifera] 93 2e-17 ref|XP_002280721.1| PREDICTED: uncharacterized protein LOC100255... 93 2e-17 ref|XP_002320926.1| predicted protein [Populus trichocarpa] gi|2... 91 7e-17 >ref|XP_002515153.1| conserved hypothetical protein [Ricinus communis] gi|223545633|gb|EEF47137.1| conserved hypothetical protein [Ricinus communis] Length = 200 Score = 97.4 bits (241), Expect = 1e-18 Identities = 45/72 (62%), Positives = 58/72 (80%) Frame = -2 Query: 332 GKWSVEETNCESQEVINSSVEQEFQTTLSYVVDVKPKLWLPVGLVEGRLCKEIKLNLLCI 153 GKWS+EE + ++SV QE++TTLSY+VDVKPK WLPV LVEGRLC+E++ NLLCI Sbjct: 126 GKWSIEEVTKQRSTGSDTSVGQEYETTLSYLVDVKPKPWLPVHLVEGRLCEEMQTNLLCI 185 Query: 152 RQQAQKAIHEEV 117 R++AQK IH+ V Sbjct: 186 REEAQKMIHKTV 197 >ref|XP_002515154.1| conserved hypothetical protein [Ricinus communis] gi|223545634|gb|EEF47138.1| conserved hypothetical protein [Ricinus communis] Length = 276 Score = 94.4 bits (233), Expect = 9e-18 Identities = 45/68 (66%), Positives = 54/68 (79%) Frame = -2 Query: 332 GKWSVEETNCESQEVINSSVEQEFQTTLSYVVDVKPKLWLPVGLVEGRLCKEIKLNLLCI 153 GKWS+E+ E + S+ Q+F+TTLSY VDVKPKLWLPV LVEGRLCKEI+ NLLCI Sbjct: 203 GKWSIEQVIKPRSEESDISLGQQFETTLSYFVDVKPKLWLPVHLVEGRLCKEIQTNLLCI 262 Query: 152 RQQAQKAI 129 R++AQK I Sbjct: 263 REEAQKMI 270 >emb|CBI37035.3| unnamed protein product [Vitis vinifera] Length = 278 Score = 93.2 bits (230), Expect = 2e-17 Identities = 44/69 (63%), Positives = 55/69 (79%) Frame = -2 Query: 332 GKWSVEETNCESQEVINSSVEQEFQTTLSYVVDVKPKLWLPVGLVEGRLCKEIKLNLLCI 153 GKWS+E+ N + E +SSV QEF TTL+YVVDV+PK WLPV LVEGRL +EIK+NL CI Sbjct: 204 GKWSIEQRNTNTWEGKDSSVGQEFYTTLTYVVDVEPKRWLPVYLVEGRLSREIKMNLTCI 263 Query: 152 RQQAQKAIH 126 R++A+K H Sbjct: 264 REEAKKRTH 272 >ref|XP_002280721.1| PREDICTED: uncharacterized protein LOC100255567 [Vitis vinifera] Length = 285 Score = 93.2 bits (230), Expect = 2e-17 Identities = 44/69 (63%), Positives = 55/69 (79%) Frame = -2 Query: 332 GKWSVEETNCESQEVINSSVEQEFQTTLSYVVDVKPKLWLPVGLVEGRLCKEIKLNLLCI 153 GKWS+E+ N + E +SSV QEF TTL+YVVDV+PK WLPV LVEGRL +EIK+NL CI Sbjct: 211 GKWSIEQRNTNTWEGKDSSVGQEFYTTLTYVVDVEPKRWLPVYLVEGRLSREIKMNLTCI 270 Query: 152 RQQAQKAIH 126 R++A+K H Sbjct: 271 REEAKKRTH 279 >ref|XP_002320926.1| predicted protein [Populus trichocarpa] gi|222861699|gb|EEE99241.1| predicted protein [Populus trichocarpa] Length = 278 Score = 91.3 bits (225), Expect = 7e-17 Identities = 43/73 (58%), Positives = 54/73 (73%) Frame = -2 Query: 332 GKWSVEETNCESQEVINSSVEQEFQTTLSYVVDVKPKLWLPVGLVEGRLCKEIKLNLLCI 153 G WS+E+ E SV QE++TTLSY+VDVKPK+WLPV L+EGR+CKEIK NL CI Sbjct: 207 GMWSIEQLAKPKTE---DSVGQEYETTLSYLVDVKPKMWLPVNLIEGRICKEIKSNLTCI 263 Query: 152 RQQAQKAIHEEVH 114 R++AQK I + H Sbjct: 264 REEAQKVIDDAQH 276