BLASTX nr result
ID: Coptis25_contig00036413
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00036413 (225 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EFN55945.1| heat shock protein 70B [Chlorella variabilis] 141 5e-32 gb|AAB91471.1| heat shock 70 protein [Spinacia oleracea] gi|2773... 140 1e-31 sp|Q08080.1|HSP7S_SPIOL RecName: Full=Stromal 70 kDa heat shock-... 140 1e-31 tpg|DAA50789.1| TPA: hypothetical protein ZEAMMB73_352617 [Zea m... 140 1e-31 gb|AFW67932.1| hypothetical protein ZEAMMB73_095591 [Zea mays] 140 1e-31 >gb|EFN55945.1| heat shock protein 70B [Chlorella variabilis] Length = 676 Score = 141 bits (356), Expect = 5e-32 Identities = 69/74 (93%), Positives = 71/74 (95%) Frame = -2 Query: 224 GLEVLRIVNEPTAASFAYGLDKKNVETILVFDLGGGTFDVSVLEFGDGVFEVLSTSGDTH 45 GLEVLRI+NEPTAAS AYGLDKK+ ETILVFDLGGGTFDVSVLE GDGVFEVLSTSGDTH Sbjct: 202 GLEVLRIINEPTAASLAYGLDKKSNETILVFDLGGGTFDVSVLEVGDGVFEVLSTSGDTH 261 Query: 44 LGGDDFDKRIVDWL 3 LGGDDFDKRIVDWL Sbjct: 262 LGGDDFDKRIVDWL 275 >gb|AAB91471.1| heat shock 70 protein [Spinacia oleracea] gi|2773050|gb|AAB96659.1| heat shock 70 protein [Spinacia oleracea] Length = 715 Score = 140 bits (353), Expect = 1e-31 Identities = 68/74 (91%), Positives = 70/74 (94%) Frame = -2 Query: 224 GLEVLRIVNEPTAASFAYGLDKKNVETILVFDLGGGTFDVSVLEFGDGVFEVLSTSGDTH 45 GLEVLRI+NEPTAAS AYG +KKN ETILVFDLGGGTFDVSVLE GDGVFEVLSTSGDTH Sbjct: 235 GLEVLRIINEPTAASLAYGFEKKNNETILVFDLGGGTFDVSVLEVGDGVFEVLSTSGDTH 294 Query: 44 LGGDDFDKRIVDWL 3 LGGDDFDKRIVDWL Sbjct: 295 LGGDDFDKRIVDWL 308 >sp|Q08080.1|HSP7S_SPIOL RecName: Full=Stromal 70 kDa heat shock-related protein, chloroplastic gi|170094|gb|AAA18570.1| 80 kDa heat shock protein, partial [Spinacia oleracea] Length = 599 Score = 140 bits (353), Expect = 1e-31 Identities = 68/74 (91%), Positives = 70/74 (94%) Frame = -2 Query: 224 GLEVLRIVNEPTAASFAYGLDKKNVETILVFDLGGGTFDVSVLEFGDGVFEVLSTSGDTH 45 GLEVLRI+NEPTAAS AYG +KKN ETILVFDLGGGTFDVSVLE GDGVFEVLSTSGDTH Sbjct: 108 GLEVLRIINEPTAASLAYGFEKKNNETILVFDLGGGTFDVSVLEVGDGVFEVLSTSGDTH 167 Query: 44 LGGDDFDKRIVDWL 3 LGGDDFDKRIVDWL Sbjct: 168 LGGDDFDKRIVDWL 181 >tpg|DAA50789.1| TPA: hypothetical protein ZEAMMB73_352617 [Zea mays] gi|414872233|tpg|DAA50790.1| TPA: hypothetical protein ZEAMMB73_352617 [Zea mays] Length = 683 Score = 140 bits (353), Expect = 1e-31 Identities = 68/74 (91%), Positives = 70/74 (94%) Frame = -2 Query: 224 GLEVLRIVNEPTAASFAYGLDKKNVETILVFDLGGGTFDVSVLEFGDGVFEVLSTSGDTH 45 GLEVLRI+NEPTAAS AYG +KKN ETILVFDLGGGTFDVSVLE GDGVFEVLSTSGDTH Sbjct: 205 GLEVLRIINEPTAASLAYGFEKKNNETILVFDLGGGTFDVSVLEVGDGVFEVLSTSGDTH 264 Query: 44 LGGDDFDKRIVDWL 3 LGGDDFDKRIVDWL Sbjct: 265 LGGDDFDKRIVDWL 278 >gb|AFW67932.1| hypothetical protein ZEAMMB73_095591 [Zea mays] Length = 683 Score = 140 bits (353), Expect = 1e-31 Identities = 68/74 (91%), Positives = 70/74 (94%) Frame = -2 Query: 224 GLEVLRIVNEPTAASFAYGLDKKNVETILVFDLGGGTFDVSVLEFGDGVFEVLSTSGDTH 45 GLEVLRI+NEPTAAS AYG +KKN ETILVFDLGGGTFDVSVLE GDGVFEVLSTSGDTH Sbjct: 205 GLEVLRIINEPTAASLAYGFEKKNNETILVFDLGGGTFDVSVLEVGDGVFEVLSTSGDTH 264 Query: 44 LGGDDFDKRIVDWL 3 LGGDDFDKRIVDWL Sbjct: 265 LGGDDFDKRIVDWL 278