BLASTX nr result
ID: Coptis25_contig00035752
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00035752 (287 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAX18166.2| CNGC2 [Gossypium hirsutum] 44 1e-07 ref|XP_002532894.1| Cyclic nucleotide-gated ion channel, putativ... 44 1e-07 ref|XP_003621352.1| Cyclic nucleotide-gated ion channel [Medicag... 44 3e-07 ref|XP_003531840.1| PREDICTED: cyclic nucleotide-gated ion chann... 42 1e-06 ref|XP_003552549.1| PREDICTED: cyclic nucleotide-gated ion chann... 42 1e-06 >gb|AAX18166.2| CNGC2 [Gossypium hirsutum] Length = 715 Score = 43.9 bits (102), Expect(2) = 1e-07 Identities = 22/31 (70%), Positives = 26/31 (83%) Frame = -2 Query: 208 GKDEIELIRYLLMGLRRDIK*YLCLGLIKKV 116 G+DE+ELI+ L GLRRDIK +LCL LIKKV Sbjct: 495 GEDEMELIKDLPEGLRRDIKRFLCLDLIKKV 525 Score = 37.0 bits (84), Expect(2) = 1e-07 Identities = 15/27 (55%), Positives = 16/27 (59%) Frame = -1 Query: 287 DMEWWMKXXXXXXXXXXRARHFERQKW 207 DMEWWMK R RH+ERQKW Sbjct: 464 DMEWWMKRRQLPSCLRQRVRHYERQKW 490 >ref|XP_002532894.1| Cyclic nucleotide-gated ion channel, putative [Ricinus communis] gi|223527328|gb|EEF29474.1| Cyclic nucleotide-gated ion channel, putative [Ricinus communis] Length = 715 Score = 43.9 bits (102), Expect(2) = 1e-07 Identities = 22/31 (70%), Positives = 26/31 (83%) Frame = -2 Query: 208 GKDEIELIRYLLMGLRRDIK*YLCLGLIKKV 116 G+DE+ELI+ L GLRRDIK YLCL LIK+V Sbjct: 495 GEDEMELIKDLPEGLRRDIKRYLCLDLIKEV 525 Score = 37.0 bits (84), Expect(2) = 1e-07 Identities = 15/27 (55%), Positives = 16/27 (59%) Frame = -1 Query: 287 DMEWWMKXXXXXXXXXXRARHFERQKW 207 DMEWWM+ R RHFERQKW Sbjct: 464 DMEWWMRRRQLPSRLRQRVRHFERQKW 490 >ref|XP_003621352.1| Cyclic nucleotide-gated ion channel [Medicago truncatula] gi|355496367|gb|AES77570.1| Cyclic nucleotide-gated ion channel [Medicago truncatula] Length = 710 Score = 43.5 bits (101), Expect(2) = 3e-07 Identities = 22/31 (70%), Positives = 26/31 (83%) Frame = -2 Query: 208 GKDEIELIRYLLMGLRRDIK*YLCLGLIKKV 116 G+DE+ELI+ L GLRRDIK +LCL LIKKV Sbjct: 491 GEDEMELIKDLPEGLRRDIKRHLCLDLIKKV 521 Score = 35.8 bits (81), Expect(2) = 3e-07 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -1 Query: 287 DMEWWMKXXXXXXXXXXRARHFERQKW 207 DMEWWM+ R RHFERQ+W Sbjct: 460 DMEWWMRRRQLPSRLRQRVRHFERQRW 486 >ref|XP_003531840.1| PREDICTED: cyclic nucleotide-gated ion channel 2-like [Glycine max] Length = 718 Score = 41.6 bits (96), Expect(2) = 1e-06 Identities = 20/31 (64%), Positives = 26/31 (83%) Frame = -2 Query: 208 GKDEIELIRYLLMGLRRDIK*YLCLGLIKKV 116 G+DE+E+I+ L GLRRDIK +LCL LI+KV Sbjct: 498 GEDEMEMIKDLPEGLRRDIKRHLCLDLIRKV 528 Score = 35.8 bits (81), Expect(2) = 1e-06 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -1 Query: 287 DMEWWMKXXXXXXXXXXRARHFERQKW 207 DMEWWM+ R RHFERQ+W Sbjct: 467 DMEWWMRRRQLPSRLRQRVRHFERQRW 493 >ref|XP_003552549.1| PREDICTED: cyclic nucleotide-gated ion channel 2-like [Glycine max] Length = 714 Score = 41.6 bits (96), Expect(2) = 1e-06 Identities = 20/31 (64%), Positives = 26/31 (83%) Frame = -2 Query: 208 GKDEIELIRYLLMGLRRDIK*YLCLGLIKKV 116 G+DE+E+I+ L GLRRDIK +LCL LI+KV Sbjct: 494 GEDEMEMIKDLPEGLRRDIKRHLCLDLIRKV 524 Score = 35.8 bits (81), Expect(2) = 1e-06 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -1 Query: 287 DMEWWMKXXXXXXXXXXRARHFERQKW 207 DMEWWM+ R RHFERQ+W Sbjct: 463 DMEWWMRRRQLPSRLRQRVRHFERQRW 489