BLASTX nr result
ID: Coptis25_contig00035638
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00035638 (486 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002299975.1| calcium dependent protein kinase 17 [Populus... 88 8e-16 ref|XP_004140192.1| PREDICTED: calcium-dependent protein kinase ... 87 1e-15 ref|XP_002313265.1| calcium dependent protein kinase 25 [Populus... 87 1e-15 ref|NP_197437.1| calcium-dependent protein kinase 34 [Arabidopsi... 85 7e-15 ref|XP_002873943.1| calcium-dependent protein kinase 34 [Arabido... 85 7e-15 >ref|XP_002299975.1| calcium dependent protein kinase 17 [Populus trichocarpa] gi|222847233|gb|EEE84780.1| calcium dependent protein kinase 17 [Populus trichocarpa] Length = 505 Score = 87.8 bits (216), Expect = 8e-16 Identities = 42/47 (89%), Positives = 45/47 (95%) Frame = -1 Query: 486 MHDGRDIKEILSEVDADNDGRINYEEFVAMMRKGNPEAASNPKKRRE 346 MHDGRDIKEI+SEVDADNDGRINY+EFVAMMRKGNPEA NPKKRR+ Sbjct: 457 MHDGRDIKEIISEVDADNDGRINYDEFVAMMRKGNPEA--NPKKRRD 501 >ref|XP_004140192.1| PREDICTED: calcium-dependent protein kinase 17-like [Cucumis sativus] gi|449480989|ref|XP_004156049.1| PREDICTED: calcium-dependent protein kinase 17-like [Cucumis sativus] Length = 535 Score = 87.0 bits (214), Expect = 1e-15 Identities = 42/50 (84%), Positives = 45/50 (90%) Frame = -1 Query: 486 MHDGRDIKEILSEVDADNDGRINYEEFVAMMRKGNPEAASNPKKRREVSI 337 MHDGRDIKEILSEVD DNDG INY+EFVAMMRKGNPEA NPKKRR+V + Sbjct: 488 MHDGRDIKEILSEVDGDNDGHINYDEFVAMMRKGNPEA--NPKKRRDVFV 535 >ref|XP_002313265.1| calcium dependent protein kinase 25 [Populus trichocarpa] gi|222849673|gb|EEE87220.1| calcium dependent protein kinase 25 [Populus trichocarpa] Length = 525 Score = 87.0 bits (214), Expect = 1e-15 Identities = 42/46 (91%), Positives = 44/46 (95%) Frame = -1 Query: 486 MHDGRDIKEILSEVDADNDGRINYEEFVAMMRKGNPEAASNPKKRR 349 MHDGRDIKEI+SEVDADNDGRINY+EFVAMMRKGNPEA NPKKRR Sbjct: 477 MHDGRDIKEIISEVDADNDGRINYDEFVAMMRKGNPEA--NPKKRR 520 >ref|NP_197437.1| calcium-dependent protein kinase 34 [Arabidopsis thaliana] gi|122249070|sp|Q3E9C0.1|CDPKY_ARATH RecName: Full=Calcium-dependent protein kinase 34 gi|91806884|gb|ABE66169.1| calcium-dependent protein kinase/CDPK [Arabidopsis thaliana] gi|332005308|gb|AED92691.1| calcium-dependent protein kinase 34 [Arabidopsis thaliana] Length = 523 Score = 84.7 bits (208), Expect = 7e-15 Identities = 41/49 (83%), Positives = 45/49 (91%) Frame = -1 Query: 486 MHDGRDIKEILSEVDADNDGRINYEEFVAMMRKGNPEAASNPKKRREVS 340 M+DGRDIKEI+SEVD DNDGRINYEEFVAMMRKGNP+ NPKKRRE+S Sbjct: 475 MNDGRDIKEIISEVDGDNDGRINYEEFVAMMRKGNPD--PNPKKRRELS 521 >ref|XP_002873943.1| calcium-dependent protein kinase 34 [Arabidopsis lyrata subsp. lyrata] gi|297319780|gb|EFH50202.1| calcium-dependent protein kinase 34 [Arabidopsis lyrata subsp. lyrata] Length = 525 Score = 84.7 bits (208), Expect = 7e-15 Identities = 41/49 (83%), Positives = 45/49 (91%) Frame = -1 Query: 486 MHDGRDIKEILSEVDADNDGRINYEEFVAMMRKGNPEAASNPKKRREVS 340 M+DGRDIKEI+SEVD DNDGRINYEEFVAMMRKGNP+ NPKKRRE+S Sbjct: 477 MNDGRDIKEIISEVDGDNDGRINYEEFVAMMRKGNPD--PNPKKRRELS 523