BLASTX nr result
ID: Coptis25_contig00035502
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00035502 (260 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003608305.1| F-box/LRR-repeat protein [Medicago truncatul... 70 2e-10 emb|CBI32919.3| unnamed protein product [Vitis vinifera] 66 3e-09 ref|NP_197379.1| F-box domain-containing protein [Arabidopsis th... 65 8e-09 dbj|BAD94200.1| putative protein [Arabidopsis thaliana] gi|11074... 65 8e-09 ref|NP_567152.1| F-box, FBD and leucine rich repeat domain-conta... 63 2e-08 >ref|XP_003608305.1| F-box/LRR-repeat protein [Medicago truncatula] gi|355509360|gb|AES90502.1| F-box/LRR-repeat protein [Medicago truncatula] Length = 482 Score = 70.1 bits (170), Expect = 2e-10 Identities = 32/52 (61%), Positives = 39/52 (75%) Frame = +1 Query: 97 EGQNDGNGEDRFSNLPEHIILHILSFLHTKHVVLTSVFSSRWRYLWTLVPNL 252 E Q++ EDR S+LP+ IILHILSFL+TKHVV T V S RWR+LW +P L Sbjct: 26 ENQSNEESEDRLSDLPDGIILHILSFLNTKHVVRTCVLSKRWRHLWKRIPTL 77 >emb|CBI32919.3| unnamed protein product [Vitis vinifera] Length = 411 Score = 66.2 bits (160), Expect = 3e-09 Identities = 29/49 (59%), Positives = 34/49 (69%) Frame = +1 Query: 112 GNGEDRFSNLPEHIILHILSFLHTKHVVLTSVFSSRWRYLWTLVPNLGF 258 G DR SNLP+ ++ HI+SFL TK V TSV S RWRYLW +PNL F Sbjct: 6 GKSRDRISNLPDAVLCHIISFLPTKFAVGTSVLSKRWRYLWASIPNLDF 54 >ref|NP_197379.1| F-box domain-containing protein [Arabidopsis thaliana] gi|334187755|ref|NP_001190332.1| F-box domain-containing protein [Arabidopsis thaliana] gi|357528794|sp|Q56YH2.2|FBD41_ARATH RecName: Full=FBD-associated F-box protein At5g18780 gi|332005227|gb|AED92610.1| F-box domain-containing protein [Arabidopsis thaliana] gi|332005228|gb|AED92611.1| F-box domain-containing protein [Arabidopsis thaliana] Length = 441 Score = 64.7 bits (156), Expect = 8e-09 Identities = 32/52 (61%), Positives = 37/52 (71%) Frame = +1 Query: 97 EGQNDGNGEDRFSNLPEHIILHILSFLHTKHVVLTSVFSSRWRYLWTLVPNL 252 +G+ G+GEDR S LPE ++ HILSFL TK V TSV SSRWR LW VP L Sbjct: 2 QGRVRGSGEDRISILPEPLLCHILSFLRTKDSVRTSVLSSRWRDLWLWVPRL 53 >dbj|BAD94200.1| putative protein [Arabidopsis thaliana] gi|110741312|dbj|BAF02206.1| hypothetical protein [Arabidopsis thaliana] Length = 308 Score = 64.7 bits (156), Expect = 8e-09 Identities = 32/52 (61%), Positives = 37/52 (71%) Frame = +1 Query: 97 EGQNDGNGEDRFSNLPEHIILHILSFLHTKHVVLTSVFSSRWRYLWTLVPNL 252 +G+ G+GEDR S LPE ++ HILSFL TK V TSV SSRWR LW VP L Sbjct: 2 QGRVRGSGEDRISILPEPLLCHILSFLRTKDSVRTSVLSSRWRDLWLWVPRL 53 >ref|NP_567152.1| F-box, FBD and leucine rich repeat domain-containing protein [Arabidopsis thaliana] gi|334302807|sp|Q8LF09.2|FDL23_ARATH RecName: Full=F-box/FBD/LRR-repeat protein At4g00160 gi|332656430|gb|AEE81830.1| F-box, FBD and leucine rich repeat domain-containing protein [Arabidopsis thaliana] Length = 453 Score = 63.2 bits (152), Expect = 2e-08 Identities = 30/47 (63%), Positives = 36/47 (76%) Frame = +1 Query: 118 GEDRFSNLPEHIILHILSFLHTKHVVLTSVFSSRWRYLWTLVPNLGF 258 G+DR S LP+ +++ ILSFL TK VV TSVFS +WR LW LVPNL F Sbjct: 14 GKDRISELPDALLIKILSFLPTKIVVATSVFSKQWRPLWKLVPNLEF 60