BLASTX nr result
ID: Coptis25_contig00035424
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00035424 (300 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004166467.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 60 1e-07 ref|XP_004136647.1| PREDICTED: pentatricopeptide repeat-containi... 60 1e-07 emb|CBI30094.3| unnamed protein product [Vitis vinifera] 60 2e-07 ref|XP_003632690.1| PREDICTED: pentatricopeptide repeat-containi... 60 2e-07 ref|XP_002529164.1| pentatricopeptide repeat-containing protein,... 56 3e-06 >ref|XP_004166467.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At2g35030, mitochondrial-like [Cucumis sativus] Length = 649 Score = 60.5 bits (145), Expect = 1e-07 Identities = 26/44 (59%), Positives = 37/44 (84%) Frame = -3 Query: 136 KDHSAGHNISRSNYLITTLTRTGKITEARRLFDEMPEKDVVTWT 5 +D SA N++RSN+LIT L + GKI EAR++F+EMP++DVV+WT Sbjct: 58 RDFSANSNVARSNWLITQLGKEGKIGEARQVFEEMPDRDVVSWT 101 >ref|XP_004136647.1| PREDICTED: pentatricopeptide repeat-containing protein At2g35030, mitochondrial-like [Cucumis sativus] Length = 649 Score = 60.5 bits (145), Expect = 1e-07 Identities = 26/44 (59%), Positives = 37/44 (84%) Frame = -3 Query: 136 KDHSAGHNISRSNYLITTLTRTGKITEARRLFDEMPEKDVVTWT 5 +D SA N++RSN+LIT L + GKI EAR++F+EMP++DVV+WT Sbjct: 58 RDFSANSNVARSNWLITQLGKEGKIGEARQVFEEMPDRDVVSWT 101 >emb|CBI30094.3| unnamed protein product [Vitis vinifera] Length = 614 Score = 60.1 bits (144), Expect = 2e-07 Identities = 26/45 (57%), Positives = 35/45 (77%) Frame = -3 Query: 136 KDHSAGHNISRSNYLITTLTRTGKITEARRLFDEMPEKDVVTWTT 2 KD + N++R N++IT L++ G+I EARRLFDEM E DV+TWTT Sbjct: 59 KDFTVDGNVARCNWMITNLSKDGRIMEARRLFDEMREPDVITWTT 103 >ref|XP_003632690.1| PREDICTED: pentatricopeptide repeat-containing protein At2g35030, mitochondrial-like [Vitis vinifera] Length = 635 Score = 60.1 bits (144), Expect = 2e-07 Identities = 26/45 (57%), Positives = 35/45 (77%) Frame = -3 Query: 136 KDHSAGHNISRSNYLITTLTRTGKITEARRLFDEMPEKDVVTWTT 2 KD + N++R N++IT L++ G+I EARRLFDEM E DV+TWTT Sbjct: 44 KDFTVDGNVARCNWMITNLSKDGRIMEARRLFDEMREPDVITWTT 88 >ref|XP_002529164.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223531388|gb|EEF33223.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 453 Score = 55.8 bits (133), Expect = 3e-06 Identities = 25/43 (58%), Positives = 32/43 (74%) Frame = -3 Query: 130 HSAGHNISRSNYLITTLTRTGKITEARRLFDEMPEKDVVTWTT 2 HSA ++R N+ IT L R GKI EAR++FD M E+DV+TWTT Sbjct: 49 HSASSEVARFNWHITKLCREGKINEARQVFDRMLERDVITWTT 91