BLASTX nr result
ID: Coptis25_contig00035411
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00035411 (305 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003638750.1| hypothetical protein MTR_142s1024 [Medicago ... 59 4e-07 >ref|XP_003638750.1| hypothetical protein MTR_142s1024 [Medicago truncatula] gi|355504685|gb|AES85888.1| hypothetical protein MTR_142s1024 [Medicago truncatula] Length = 92 Score = 58.9 bits (141), Expect = 4e-07 Identities = 28/63 (44%), Positives = 41/63 (65%) Frame = -3 Query: 291 DFQFGVGMPGGAEAILHVVNRMVHANKDNTFHTMMLVDFQNTFNLVDRASMLREAYIRCS 112 DFQFGV + GGAEAILH NR++ + ++ DF N FNL+D ++LR+ +RC Sbjct: 29 DFQFGVRVSGGAEAILHNANRVLSQQHGDGSLVVITKDFSNAFNLLDMFALLRKVRVRCL 88 Query: 111 AIA 103 +I+ Sbjct: 89 SIS 91