BLASTX nr result
ID: Coptis25_contig00035347
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00035347 (309 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003533464.1| PREDICTED: transcription initiation factor T... 44 4e-08 ref|XP_003523903.1| PREDICTED: transcription initiation factor T... 44 5e-08 ref|XP_003612586.1| Transcription initiation factor TFIID subuni... 45 6e-07 >ref|XP_003533464.1| PREDICTED: transcription initiation factor TFIID subunit 1-A-like [Glycine max] Length = 1910 Score = 43.9 bits (102), Expect(2) = 4e-08 Identities = 20/36 (55%), Positives = 25/36 (69%), Gaps = 1/36 (2%) Frame = +2 Query: 17 KPLRGGVSCRACGQMGHIRTNKKCPKY-EHLDIQVK 121 KP R C ACG+ GH+RTNK CPKY E L+ Q++ Sbjct: 1425 KPSRETFVCGACGKAGHMRTNKNCPKYGEDLETQLE 1460 Score = 38.1 bits (87), Expect(2) = 4e-08 Identities = 24/59 (40%), Positives = 33/59 (55%) Frame = +1 Query: 130 GKSNVLDPSSHFHHKTLMEKSTSEGATEIPVVETSENSRIAVSETKVPHLRFKWGPAEK 306 GKS+ +DPSS HK +KS S+ AT++ V+ S TK+P L+FK EK Sbjct: 1469 GKSSFVDPSSLSQHKAPSKKSMSKSATKVAPVDNS---------TKIP-LKFKCSSTEK 1517 >ref|XP_003523903.1| PREDICTED: transcription initiation factor TFIID subunit 1-A-like [Glycine max] Length = 1919 Score = 43.9 bits (102), Expect(2) = 5e-08 Identities = 20/36 (55%), Positives = 25/36 (69%), Gaps = 1/36 (2%) Frame = +2 Query: 17 KPLRGGVSCRACGQMGHIRTNKKCPKY-EHLDIQVK 121 KP R C ACG+ GH+RTNK CPKY E L+ Q++ Sbjct: 1435 KPSRETFVCGACGKAGHMRTNKNCPKYGEDLETQLE 1470 Score = 37.7 bits (86), Expect(2) = 5e-08 Identities = 24/59 (40%), Positives = 33/59 (55%) Frame = +1 Query: 130 GKSNVLDPSSHFHHKTLMEKSTSEGATEIPVVETSENSRIAVSETKVPHLRFKWGPAEK 306 GKS+ +DPSS HK +KS S+G T+I V+ S +K+P L+FK EK Sbjct: 1479 GKSSFVDPSSLSQHKAPSKKSMSKGTTKIAPVDNS---------SKIP-LKFKCSSTEK 1527 >ref|XP_003612586.1| Transcription initiation factor TFIID subunit 1-A [Medicago truncatula] gi|355513921|gb|AES95544.1| Transcription initiation factor TFIID subunit 1-A [Medicago truncatula] Length = 2196 Score = 45.1 bits (105), Expect(2) = 6e-07 Identities = 18/27 (66%), Positives = 20/27 (74%) Frame = +2 Query: 17 KPLRGGVSCRACGQMGHIRTNKKCPKY 97 KP R C ACGQ+GH+RTNK CPKY Sbjct: 1696 KPSRETFVCGACGQLGHMRTNKNCPKY 1722 Score = 33.1 bits (74), Expect(2) = 6e-07 Identities = 23/59 (38%), Positives = 31/59 (52%) Frame = +1 Query: 130 GKSNVLDPSSHFHHKTLMEKSTSEGATEIPVVETSENSRIAVSETKVPHLRFKWGPAEK 306 GKS+ DPSS H+ +KS S+ T++ VE S TK+P L+FK EK Sbjct: 1740 GKSSFGDPSSQSQHQLPSKKSISKIVTKLAPVENS---------TKIP-LKFKCSSTEK 1788