BLASTX nr result
ID: Coptis25_contig00035333
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00035333 (312 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADD71922.1| BAHD-type acyltransferase [Actaea racemosa] 60 2e-07 >gb|ADD71922.1| BAHD-type acyltransferase [Actaea racemosa] Length = 424 Score = 60.1 bits (144), Expect = 2e-07 Identities = 27/58 (46%), Positives = 37/58 (63%) Frame = +2 Query: 104 PPQPQNSFGNLVFGIILPPWTTGSEPELHCLVRQLQEKIRKIDSDYTKQQLADKGLLL 277 PP P +SFGNL + PW EPEL+CLV+QL+E IRK++ + ++ AD LL Sbjct: 270 PPLPPHSFGNLAIRLTSQPWPAEKEPELNCLVKQLRETIRKVNGGFVEKLQADNAELL 327