BLASTX nr result
ID: Coptis25_contig00035300
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00035300 (386 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002527364.1| conserved hypothetical protein [Ricinus comm... 57 2e-06 >ref|XP_002527364.1| conserved hypothetical protein [Ricinus communis] gi|223533283|gb|EEF35036.1| conserved hypothetical protein [Ricinus communis] Length = 437 Score = 56.6 bits (135), Expect = 2e-06 Identities = 31/73 (42%), Positives = 40/73 (54%) Frame = +2 Query: 146 MVSYTNCTPKQCIWTKPKEDTVKLNTDGALPDARTGSGGLIRDNEG*VIQAFAGSGGQ*C 325 ++S + + CIW KP +KLNTDG++ G GGL+RDNEG I AF Sbjct: 261 LISPVTGSIRWCIWKKPDVGWIKLNTDGSVDRQHAGFGGLLRDNEGNAICAFVSKAPLDD 320 Query: 326 VLYQELPAIHRGL 364 + EL AI RGL Sbjct: 321 IFLVELWAIWRGL 333