BLASTX nr result
ID: Coptis25_contig00035175
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00035175 (417 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002521104.1| protein with unknown function [Ricinus commu... 111 5e-23 ref|XP_003532296.1| PREDICTED: PPPDE peptidase domain-containing... 108 4e-22 gb|AFK47131.1| unknown [Medicago truncatula] 108 6e-22 ref|XP_003622934.1| PPPDE peptidase domain-containing protein [M... 108 6e-22 ref|XP_003622933.1| PPPDE peptidase domain-containing protein [M... 108 6e-22 >ref|XP_002521104.1| protein with unknown function [Ricinus communis] gi|223539673|gb|EEF41255.1| protein with unknown function [Ricinus communis] Length = 271 Score = 111 bits (278), Expect = 5e-23 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = +1 Query: 124 MAEDGQKVSLNVYDLSQGLARQLSTSFLGKAIEGIWHTGVVVYGNEYYFGGGIQH 288 MAEDG KV+LNVYDLSQGLARQLST+FLGKAIEGIWHTG+VVYGNEYYFGGGIQH Sbjct: 1 MAEDGHKVTLNVYDLSQGLARQLSTTFLGKAIEGIWHTGIVVYGNEYYFGGGIQH 55 >ref|XP_003532296.1| PREDICTED: PPPDE peptidase domain-containing protein 2-like [Glycine max] Length = 280 Score = 108 bits (270), Expect = 4e-22 Identities = 50/56 (89%), Positives = 54/56 (96%) Frame = +1 Query: 124 MAEDGQKVSLNVYDLSQGLARQLSTSFLGKAIEGIWHTGVVVYGNEYYFGGGIQHA 291 MAE+G +V+LNVYDLSQGLARQLS SFLGKAIEGIWHTGVVVYGNEYYFGGGIQH+ Sbjct: 1 MAEEGHRVTLNVYDLSQGLARQLSMSFLGKAIEGIWHTGVVVYGNEYYFGGGIQHS 56 >gb|AFK47131.1| unknown [Medicago truncatula] Length = 281 Score = 108 bits (269), Expect = 6e-22 Identities = 49/55 (89%), Positives = 54/55 (98%) Frame = +1 Query: 124 MAEDGQKVSLNVYDLSQGLARQLSTSFLGKAIEGIWHTGVVVYGNEYYFGGGIQH 288 MAE+G +V+LNVYDLSQGLARQLSTSFLGKAIEGIWHTG+VVYGNEY+FGGGIQH Sbjct: 1 MAEEGYRVTLNVYDLSQGLARQLSTSFLGKAIEGIWHTGIVVYGNEYFFGGGIQH 55 >ref|XP_003622934.1| PPPDE peptidase domain-containing protein [Medicago truncatula] gi|355497949|gb|AES79152.1| PPPDE peptidase domain-containing protein [Medicago truncatula] Length = 170 Score = 108 bits (269), Expect = 6e-22 Identities = 49/55 (89%), Positives = 54/55 (98%) Frame = +1 Query: 124 MAEDGQKVSLNVYDLSQGLARQLSTSFLGKAIEGIWHTGVVVYGNEYYFGGGIQH 288 MAE+G +V+LNVYDLSQGLARQLSTSFLGKAIEGIWHTG+VVYGNEY+FGGGIQH Sbjct: 1 MAEEGYRVTLNVYDLSQGLARQLSTSFLGKAIEGIWHTGIVVYGNEYFFGGGIQH 55 >ref|XP_003622933.1| PPPDE peptidase domain-containing protein [Medicago truncatula] gi|355497948|gb|AES79151.1| PPPDE peptidase domain-containing protein [Medicago truncatula] Length = 281 Score = 108 bits (269), Expect = 6e-22 Identities = 49/55 (89%), Positives = 54/55 (98%) Frame = +1 Query: 124 MAEDGQKVSLNVYDLSQGLARQLSTSFLGKAIEGIWHTGVVVYGNEYYFGGGIQH 288 MAE+G +V+LNVYDLSQGLARQLSTSFLGKAIEGIWHTG+VVYGNEY+FGGGIQH Sbjct: 1 MAEEGYRVTLNVYDLSQGLARQLSTSFLGKAIEGIWHTGIVVYGNEYFFGGGIQH 55