BLASTX nr result
ID: Coptis25_contig00035083
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00035083 (655 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004136211.1| PREDICTED: pentatricopeptide repeat-containi... 88 1e-15 ref|XP_003581359.1| PREDICTED: pentatricopeptide repeat-containi... 88 1e-15 ref|XP_003543566.1| PREDICTED: pentatricopeptide repeat-containi... 88 2e-15 ref|XP_002326752.1| predicted protein [Populus trichocarpa] gi|2... 88 2e-15 gb|EEE55297.1| hypothetical protein OsJ_03249 [Oryza sativa Japo... 87 2e-15 >ref|XP_004136211.1| PREDICTED: pentatricopeptide repeat-containing protein At1g31920-like [Cucumis sativus] gi|449508034|ref|XP_004163198.1| PREDICTED: pentatricopeptide repeat-containing protein At1g31920-like [Cucumis sativus] Length = 606 Score = 88.2 bits (217), Expect = 1e-15 Identities = 35/46 (76%), Positives = 41/46 (89%) Frame = -2 Query: 654 KNLRSCNDCHSFIKLISKIFKREIIVRDRNRFHHFRDGLCSCRDYW 517 +NLR CNDCHS+ KL+S I++REI VRDRNRFHHF+DG CSCRDYW Sbjct: 561 RNLRMCNDCHSYTKLVSMIYEREITVRDRNRFHHFKDGNCSCRDYW 606 >ref|XP_003581359.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like, partial [Brachypodium distachyon] Length = 745 Score = 88.2 bits (217), Expect = 1e-15 Identities = 37/46 (80%), Positives = 40/46 (86%) Frame = -2 Query: 654 KNLRSCNDCHSFIKLISKIFKREIIVRDRNRFHHFRDGLCSCRDYW 517 KNLR C DCHS KLISK++ REIIVRDRNRFHHF+DGLCSC DYW Sbjct: 700 KNLRVCIDCHSATKLISKVYNREIIVRDRNRFHHFKDGLCSCNDYW 745 >ref|XP_003543566.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Glycine max] Length = 572 Score = 87.8 bits (216), Expect = 2e-15 Identities = 36/46 (78%), Positives = 42/46 (91%) Frame = -2 Query: 654 KNLRSCNDCHSFIKLISKIFKREIIVRDRNRFHHFRDGLCSCRDYW 517 KNLRSC DCH F+KLISKI+KR+IIVRDR RFHHF++G CSC+DYW Sbjct: 527 KNLRSCEDCHEFMKLISKIYKRDIIVRDRIRFHHFKNGECSCKDYW 572 >ref|XP_002326752.1| predicted protein [Populus trichocarpa] gi|222834074|gb|EEE72551.1| predicted protein [Populus trichocarpa] Length = 559 Score = 87.8 bits (216), Expect = 2e-15 Identities = 35/46 (76%), Positives = 41/46 (89%) Frame = -2 Query: 654 KNLRSCNDCHSFIKLISKIFKREIIVRDRNRFHHFRDGLCSCRDYW 517 +NLR CNDCH++ KLIS I++REI VRDRNRFHHF+DG CSCRDYW Sbjct: 514 RNLRMCNDCHTYTKLISVIYQREITVRDRNRFHHFKDGTCSCRDYW 559 >gb|EEE55297.1| hypothetical protein OsJ_03249 [Oryza sativa Japonica Group] Length = 706 Score = 87.4 bits (215), Expect = 2e-15 Identities = 33/46 (71%), Positives = 40/46 (86%) Frame = -2 Query: 654 KNLRSCNDCHSFIKLISKIFKREIIVRDRNRFHHFRDGLCSCRDYW 517 KNLR C DCH + K+ISK+F REI++RDRNRFHHF+DG CSC+DYW Sbjct: 661 KNLRVCEDCHDYTKMISKVFNREIVMRDRNRFHHFKDGACSCKDYW 706