BLASTX nr result
ID: Coptis25_contig00035033
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00035033 (368 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_085566.1| hypothetical protein ArthMp044 [Arabidopsis tha... 88 6e-16 ref|YP_002608374.1| orf102 [Vitis vinifera] gi|209954171|emb|CAQ... 77 1e-12 emb|CAA27743.1| URF-1 [Citrullus lanatus] 64 1e-08 gb|AFW63421.1| hypothetical protein ZEAMMB73_397358 [Zea mays] g... 62 6e-08 sp|P08834.1|NU1M_CITLA RecName: Full=NADH-ubiquinone oxidoreduct... 55 6e-06 >ref|NP_085566.1| hypothetical protein ArthMp044 [Arabidopsis thaliana] gi|45477063|sp|P92544.1|M1130_ARATH RecName: Full=Uncharacterized mitochondrial protein AtMg01130; AltName: Full=ORF106f gi|1785767|emb|CAA69797.1| unnamed protein product [Arabidopsis thaliana] Length = 106 Score = 88.2 bits (217), Expect = 6e-16 Identities = 52/70 (74%), Positives = 56/70 (80%) Frame = -1 Query: 215 MIVTALQILFTLIRYVTETKFFRSVSVLFSDSEDEPADPNIIYEEPDD*ASSSEKDVSDA 36 M+VTALQILF+LIRYVTET RSVSVLFSDSEDEP DD ASSS+KDVSDA Sbjct: 1 MMVTALQILFSLIRYVTET--IRSVSVLFSDSEDEP----------DDEASSSDKDVSDA 48 Query: 35 TLPARTTFSI 6 TLPARTT+SI Sbjct: 49 TLPARTTYSI 58 >ref|YP_002608374.1| orf102 [Vitis vinifera] gi|209954171|emb|CAQ77618.1| orf102 [Vitis vinifera] gi|239764768|gb|ACS15237.1| ORF102 [Vitis vinifera] Length = 101 Score = 77.0 bits (188), Expect = 1e-12 Identities = 40/45 (88%), Positives = 41/45 (91%) Frame = -2 Query: 172 MSLKQSSSVLSLFYFRIPRMSRPILTSFMRSRTTKPPPQKKMSPT 38 MSLKQS VLSL YFRIPRMSRPILTSFMRS TTKPPPQ+KMSPT Sbjct: 1 MSLKQS--VLSLLYFRIPRMSRPILTSFMRSWTTKPPPQRKMSPT 43 >emb|CAA27743.1| URF-1 [Citrullus lanatus] Length = 316 Score = 64.3 bits (155), Expect = 1e-08 Identities = 31/35 (88%), Positives = 31/35 (88%) Frame = -2 Query: 115 MSRPILTSFMRSRTTKPPPQKKMSPTLLSRQEPLF 11 MSRPILTSFMRSRTTKPPPQ KMSP LSRQEP F Sbjct: 1 MSRPILTSFMRSRTTKPPPQIKMSPMRLSRQEPFF 35 >gb|AFW63421.1| hypothetical protein ZEAMMB73_397358 [Zea mays] gi|413923490|gb|AFW63422.1| hypothetical protein ZEAMMB73_397358 [Zea mays] gi|413923799|gb|AFW63731.1| hypothetical protein ZEAMMB73_879039 [Zea mays] gi|413923800|gb|AFW63732.1| hypothetical protein ZEAMMB73_879039 [Zea mays] Length = 172 Score = 61.6 bits (148), Expect = 6e-08 Identities = 30/37 (81%), Positives = 32/37 (86%) Frame = -1 Query: 143 VSVLFSDSEDEPADPNIIYEEPDD*ASSSEKDVSDAT 33 V VLFSD +DEPADPNII EEPDD AS S+KDVSDAT Sbjct: 9 VFVLFSDDKDEPADPNIILEEPDDEASKSDKDVSDAT 45 >sp|P08834.1|NU1M_CITLA RecName: Full=NADH-ubiquinone oxidoreductase chain 1; AltName: Full=NADH dehydrogenase subunit 1 Length = 316 Score = 55.1 bits (131), Expect = 6e-06 Identities = 28/35 (80%), Positives = 28/35 (80%) Frame = -2 Query: 115 MSRPILTSFMRSRTTKPPPQKKMSPTLLSRQEPLF 11 MS PILTSFMRS TTKPPPQ KMSP LS QEP F Sbjct: 1 MSWPILTSFMRSWTTKPPPQIKMSPMRLSWQEPFF 35