BLASTX nr result
ID: Coptis25_contig00035014
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00035014 (308 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002960871.1| hypothetical protein SELMODRAFT_270172 [Sela... 82 1e-20 ref|XP_003623681.1| hypothetical protein MTR_7g074450 [Medicago ... 80 1e-20 ref|XP_002519972.1| conserved hypothetical protein [Ricinus comm... 80 2e-20 ref|XP_002266836.1| PREDICTED: uncharacterized protein LOC100257... 79 4e-20 emb|CAN60711.1| hypothetical protein VITISV_036440 [Vitis vinifera] 79 4e-20 >ref|XP_002960871.1| hypothetical protein SELMODRAFT_270172 [Selaginella moellendorffii] gi|302767442|ref|XP_002967141.1| hypothetical protein SELMODRAFT_144814 [Selaginella moellendorffii] gi|300165132|gb|EFJ31740.1| hypothetical protein SELMODRAFT_144814 [Selaginella moellendorffii] gi|300171810|gb|EFJ38410.1| hypothetical protein SELMODRAFT_270172 [Selaginella moellendorffii] Length = 460 Score = 82.0 bits (201), Expect(2) = 1e-20 Identities = 36/82 (43%), Positives = 59/82 (71%), Gaps = 1/82 (1%) Frame = +1 Query: 64 PSNTYFVFE-QMFLTFRNRTISAWNLQGKQMTSFQDHLLYYTDLNRSTICTTTDQNIIIS 240 PS F++E Q+FLTFRNRT++ WN +G+ +TSF+DHLL+Y D N + I T++Q++IIS Sbjct: 315 PSAFIFLYENQLFLTFRNRTVAVWNFRGELVTSFEDHLLWYPDCNTNNIYITSEQDLIIS 374 Query: 241 YCRDEGAEMDKECRFPLNSLFT 306 YC+ +G + + ++++ T Sbjct: 375 YCKAQGCDEETVGSINISNILT 396 Score = 42.7 bits (99), Expect(2) = 1e-20 Identities = 19/24 (79%), Positives = 24/24 (100%) Frame = +2 Query: 2 KEVNFIEQFNEKLLVKQQSENLQI 73 K+++FIEQFNEKLLVKQ++ENLQI Sbjct: 273 KKLDFIEQFNEKLLVKQENENLQI 296 >ref|XP_003623681.1| hypothetical protein MTR_7g074450 [Medicago truncatula] gi|355498696|gb|AES79899.1| hypothetical protein MTR_7g074450 [Medicago truncatula] Length = 475 Score = 80.5 bits (197), Expect(2) = 1e-20 Identities = 36/68 (52%), Positives = 52/68 (76%), Gaps = 1/68 (1%) Frame = +1 Query: 64 PSNTYFVFE-QMFLTFRNRTISAWNLQGKQMTSFQDHLLYYTDLNRSTICTTTDQNIIIS 240 PS F++E Q+FLTFRNRT+S WN +G+ +TSF+DHLL++ D N + I T+DQ++IIS Sbjct: 321 PSAFIFLYENQLFLTFRNRTVSVWNFRGELVTSFEDHLLWHPDCNTNNIYITSDQDLIIS 380 Query: 241 YCRDEGAE 264 YC+ E + Sbjct: 381 YCKAESED 388 Score = 43.9 bits (102), Expect(2) = 1e-20 Identities = 20/24 (83%), Positives = 24/24 (100%) Frame = +2 Query: 2 KEVNFIEQFNEKLLVKQQSENLQI 73 K+V+FIEQFNEKLLVKQ++ENLQI Sbjct: 279 KKVDFIEQFNEKLLVKQENENLQI 302 >ref|XP_002519972.1| conserved hypothetical protein [Ricinus communis] gi|223540736|gb|EEF42296.1| conserved hypothetical protein [Ricinus communis] Length = 470 Score = 79.7 bits (195), Expect(2) = 2e-20 Identities = 36/68 (52%), Positives = 52/68 (76%), Gaps = 1/68 (1%) Frame = +1 Query: 64 PSNTYFVFE-QMFLTFRNRTISAWNLQGKQMTSFQDHLLYYTDLNRSTICTTTDQNIIIS 240 PS F++E Q+FLTFRNRT++ WN +G+ +TSF+DHLL++ D N + I T+DQ++IIS Sbjct: 314 PSAFIFLYENQLFLTFRNRTVAVWNFRGELVTSFEDHLLWHPDCNTNNIYITSDQDLIIS 373 Query: 241 YCRDEGAE 264 YC+ E E Sbjct: 374 YCKAETEE 381 Score = 43.9 bits (102), Expect(2) = 2e-20 Identities = 20/24 (83%), Positives = 24/24 (100%) Frame = +2 Query: 2 KEVNFIEQFNEKLLVKQQSENLQI 73 K+V+FIEQFNEKLLVKQ++ENLQI Sbjct: 272 KKVDFIEQFNEKLLVKQENENLQI 295 >ref|XP_002266836.1| PREDICTED: uncharacterized protein LOC100257044 [Vitis vinifera] gi|296085818|emb|CBI31142.3| unnamed protein product [Vitis vinifera] Length = 464 Score = 79.0 bits (193), Expect(2) = 4e-20 Identities = 34/68 (50%), Positives = 53/68 (77%), Gaps = 1/68 (1%) Frame = +1 Query: 64 PSNTYFVFE-QMFLTFRNRTISAWNLQGKQMTSFQDHLLYYTDLNRSTICTTTDQNIIIS 240 PS F++E Q+FLTFRNRT++ WN +G+ +TSF+DHLL++ D N + I T+DQ++IIS Sbjct: 313 PSAFIFLYENQLFLTFRNRTVAVWNFRGELVTSFEDHLLWHPDCNTNNIYITSDQDLIIS 372 Query: 241 YCRDEGAE 264 YC+ + ++ Sbjct: 373 YCKADSSD 380 Score = 43.9 bits (102), Expect(2) = 4e-20 Identities = 20/24 (83%), Positives = 24/24 (100%) Frame = +2 Query: 2 KEVNFIEQFNEKLLVKQQSENLQI 73 K+V+FIEQFNEKLLVKQ++ENLQI Sbjct: 271 KKVDFIEQFNEKLLVKQENENLQI 294 >emb|CAN60711.1| hypothetical protein VITISV_036440 [Vitis vinifera] Length = 464 Score = 79.0 bits (193), Expect(2) = 4e-20 Identities = 34/68 (50%), Positives = 53/68 (77%), Gaps = 1/68 (1%) Frame = +1 Query: 64 PSNTYFVFE-QMFLTFRNRTISAWNLQGKQMTSFQDHLLYYTDLNRSTICTTTDQNIIIS 240 PS F++E Q+FLTFRNRT++ WN +G+ +TSF+DHLL++ D N + I T+DQ++IIS Sbjct: 313 PSAFIFLYENQLFLTFRNRTVAVWNFRGELVTSFEDHLLWHPDCNTNNIYITSDQDLIIS 372 Query: 241 YCRDEGAE 264 YC+ + ++ Sbjct: 373 YCKADSSD 380 Score = 43.9 bits (102), Expect(2) = 4e-20 Identities = 20/24 (83%), Positives = 24/24 (100%) Frame = +2 Query: 2 KEVNFIEQFNEKLLVKQQSENLQI 73 K+V+FIEQFNEKLLVKQ++ENLQI Sbjct: 271 KKVDFIEQFNEKLLVKQENENLQI 294