BLASTX nr result
ID: Coptis25_contig00034966
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00034966 (325 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002269875.2| PREDICTED: endoglucanase 9-like [Vitis vinif... 64 2e-08 emb|CAN63305.1| hypothetical protein VITISV_003341 [Vitis vinifera] 64 2e-08 gb|AAQ55294.1| endo-1,4-beta-glucanase [Malus x domestica] 59 5e-07 ref|XP_004141534.1| PREDICTED: endoglucanase 9-like [Cucumis sat... 58 9e-07 ref|XP_002534766.1| endo-1,4-beta-glucanase, putative [Ricinus c... 58 9e-07 >ref|XP_002269875.2| PREDICTED: endoglucanase 9-like [Vitis vinifera] gi|297734804|emb|CBI17038.3| unnamed protein product [Vitis vinifera] Length = 494 Score = 63.5 bits (153), Expect = 2e-08 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +2 Query: 5 DDRTDYSHSEPATYINAALVGPLAYLAGSYKT 100 D+RTDYSHSEPATYINAA+VGPLAYLAGSY + Sbjct: 463 DERTDYSHSEPATYINAAIVGPLAYLAGSYSS 494 >emb|CAN63305.1| hypothetical protein VITISV_003341 [Vitis vinifera] Length = 348 Score = 63.5 bits (153), Expect = 2e-08 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +2 Query: 5 DDRTDYSHSEPATYINAALVGPLAYLAGSYKT 100 D+RTDYSHSEPATYINAA+VGPLAYLAGSY + Sbjct: 317 DERTDYSHSEPATYINAAIVGPLAYLAGSYSS 348 >gb|AAQ55294.1| endo-1,4-beta-glucanase [Malus x domestica] Length = 497 Score = 58.5 bits (140), Expect = 5e-07 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +2 Query: 5 DDRTDYSHSEPATYINAALVGPLAYLAGSYKT 100 DDR DYSHSEPATYIN A+VGPLA+ AGSY++ Sbjct: 466 DDRGDYSHSEPATYINGAIVGPLAFFAGSYRS 497 >ref|XP_004141534.1| PREDICTED: endoglucanase 9-like [Cucumis sativus] Length = 491 Score = 57.8 bits (138), Expect = 9e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +2 Query: 5 DDRTDYSHSEPATYINAALVGPLAYLAGSY 94 DDRTDYSHSEPATYINAALVGPLA+ +G + Sbjct: 462 DDRTDYSHSEPATYINAALVGPLAFFSGKH 491 >ref|XP_002534766.1| endo-1,4-beta-glucanase, putative [Ricinus communis] gi|223524605|gb|EEF27617.1| endo-1,4-beta-glucanase, putative [Ricinus communis] Length = 282 Score = 57.8 bits (138), Expect = 9e-07 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = +2 Query: 5 DDRTDYSHSEPATYINAALVGPLAYLAGS 91 DDR+DYSHSEPATYINAA+VGPLAY AG+ Sbjct: 251 DDRSDYSHSEPATYINAAIVGPLAYFAGT 279