BLASTX nr result
ID: Coptis25_contig00034901
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00034901 (272 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002281535.1| PREDICTED: pentatricopeptide repeat-containi... 69 4e-10 emb|CAN82371.1| hypothetical protein VITISV_027622 [Vitis vinifera] 69 4e-10 >ref|XP_002281535.1| PREDICTED: pentatricopeptide repeat-containing protein At3g57430, chloroplastic [Vitis vinifera] gi|297741370|emb|CBI32501.3| unnamed protein product [Vitis vinifera] Length = 697 Score = 68.9 bits (167), Expect = 4e-10 Identities = 31/63 (49%), Positives = 48/63 (76%) Frame = +1 Query: 82 YALILQRIKHLKPLKQIHSHIITSGLSQSIFLSNKLINCYAFFGFLNESERVFWSIRHKN 261 +A IL+++K LKPL+QIH+ IITSGL+ + FLSN L+N Y + G L +++++F +KN Sbjct: 27 HASILRKLKDLKPLQQIHAQIITSGLTHNTFLSNSLMNAYVYCGLLADAKQIFHHTPYKN 86 Query: 262 IVS 270 +VS Sbjct: 87 VVS 89 >emb|CAN82371.1| hypothetical protein VITISV_027622 [Vitis vinifera] Length = 697 Score = 68.9 bits (167), Expect = 4e-10 Identities = 32/65 (49%), Positives = 49/65 (75%) Frame = +1 Query: 76 KSYALILQRIKHLKPLKQIHSHIITSGLSQSIFLSNKLINCYAFFGFLNESERVFWSIRH 255 +S+A IL+++K LKPL+QIH+ IITSGL+ + FLSN L+N Y + G L +++++F Sbjct: 25 QSHASILRKLKDLKPLQQIHAQIITSGLTHNTFLSNSLMNAYVYCGLLADAKQIFHHTPC 84 Query: 256 KNIVS 270 KN+VS Sbjct: 85 KNVVS 89