BLASTX nr result
ID: Coptis25_contig00034688
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00034688 (299 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002320616.1| predicted protein [Populus trichocarpa] gi|2... 44 7e-06 ref|XP_002521162.1| conserved hypothetical protein [Ricinus comm... 44 9e-06 >ref|XP_002320616.1| predicted protein [Populus trichocarpa] gi|222861389|gb|EEE98931.1| predicted protein [Populus trichocarpa] Length = 300 Score = 44.3 bits (103), Expect(3) = 7e-06 Identities = 19/32 (59%), Positives = 27/32 (84%) Frame = -2 Query: 97 SK*STNTVTPFRSVRMFFYLAFIASASLGGII 2 +K + ++PFR+VRMFFYLAF+AS +LGG+I Sbjct: 50 AKIRSEVLSPFRTVRMFFYLAFLASGALGGLI 81 Score = 28.9 bits (63), Expect(3) = 7e-06 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = -1 Query: 254 ITCSAANKPSSPTEI 210 ITCSAANKPS TE+ Sbjct: 32 ITCSAANKPSPSTEV 46 Score = 20.4 bits (41), Expect(3) = 7e-06 Identities = 9/10 (90%), Positives = 10/10 (100%) Frame = -3 Query: 108 TAKIRSEVLT 79 TAKIRSEVL+ Sbjct: 49 TAKIRSEVLS 58 >ref|XP_002521162.1| conserved hypothetical protein [Ricinus communis] gi|223539731|gb|EEF41313.1| conserved hypothetical protein [Ricinus communis] Length = 331 Score = 43.5 bits (101), Expect(3) = 9e-06 Identities = 20/32 (62%), Positives = 25/32 (78%) Frame = -2 Query: 97 SK*STNTVTPFRSVRMFFYLAFIASASLGGII 2 +K + ++PFRSVRMFFYLAFIAS LG +I Sbjct: 80 AKIRSEVLSPFRSVRMFFYLAFIASGGLGALI 111 Score = 29.3 bits (64), Expect(3) = 9e-06 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = -1 Query: 254 ITCSAANKPSSPTEI 210 I CSAANKPS PT+I Sbjct: 62 IACSAANKPSPPTDI 76 Score = 20.4 bits (41), Expect(3) = 9e-06 Identities = 9/10 (90%), Positives = 10/10 (100%) Frame = -3 Query: 108 TAKIRSEVLT 79 TAKIRSEVL+ Sbjct: 79 TAKIRSEVLS 88