BLASTX nr result
ID: Coptis25_contig00034453
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00034453 (730 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003518074.1| PREDICTED: BTB/POZ domain-containing protein... 60 5e-07 >ref|XP_003518074.1| PREDICTED: BTB/POZ domain-containing protein At5g66560-like [Glycine max] Length = 655 Score = 60.1 bits (144), Expect = 5e-07 Identities = 40/105 (38%), Positives = 57/105 (54%), Gaps = 3/105 (2%) Frame = +3 Query: 423 QPNPQSNDFVCTTTFKRFLGSQYNRRTALEELQRYHLRSQG*PSRVINHFL-Q*EGSRHL 599 +P+ + + CTT + + + T L ++ L S+ SR ++ + Q E + H Sbjct: 6 KPSSKGQAWFCTTGLPSDIVVEVDDMTF--HLHKFPLMSK---SRKLHLLITQQEAATHS 60 Query: 600 STAQQQGEEEVKDNEIE--LHITLQDFPGSSETFEFAAKFCYGVK 728 S AQQQ E E +D +E H+T FPG SE FE AAKFCYGVK Sbjct: 61 SAAQQQQENEDEDEIVEEQCHVTFTGFPGGSEAFEMAAKFCYGVK 105